Overview

  • Product name

  • Description

    Rabbit polyclonal to PAQR5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PAQR5 aa 1-51.
    Sequence:

    MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETL N


    Database link: Q9NXK6

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human lung and kidney tissues. ICC/IF: A431 and HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 38 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    PAQR5 (Progestin and adipoQ receptor family member V) is a steroid membrane receptor which binds progesterone. It may be involved in oocyte maturation. It is an integral membrane protein and is expressed in kidney, colon, adrenal gland and lung. It belongs to the ADIPOR family.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • FLJ20190 antibody
    • Membrane progestin receptor gamma antibody
    • mPR gamma antibody
    • MPRG antibody
    • PAQR 5 antibody
    • Progestin and adipoQ receptor family member V antibody
    see all

Images

  • Anti-PAQR5 antibody (ab236798) at 1/500 dilution + A549 (Human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa

  • Paraffin-embedded human lung tissue tissue stained for PAQR5 using ab236798 at 1/100 dilution in immunohistochemical analysis.

  • A431 (Human epidermoid carcinoma cell line) cells stained for PAQR5 (green) using ab236798 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue tissue stained for PAQR5 using ab236798 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for PAQR5 (green) using ab236798 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up