Overview

  • Product name

    Anti-PAR1/Thrombin Receptor antibody [5E2E6]
    See all PAR1/Thrombin Receptor primary antibodies
  • Description

    Mouse monoclonal [5E2E6] to PAR1/Thrombin Receptor
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PAR1/Thrombin Receptor aa 42-176. (Expressed in E.coli).
    Sequence:

    SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISED ASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYM LHLATADVLFVSVLPFKISYYFSGSDWQFGSELCR


    Database link: P25116

  • Positive control

    • WB: Recombinant human PAR1/Thrombin Receptor protein; PAR1/Thrombin Receptor -hIgGFc transfected HEK293 cell lysate. IHC-P: Human rectum cancer.

Properties

Applications

Our Abpromise guarantee covers the use of ab233741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000.
ELISA 1/10000.

Target

  • Function

    High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
  • Tissue specificity

    Platelets and vascular endothelial cells.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.
    Phosphorylated; probably mediating desensitization prior to the uncoupling and internalization of the receptor.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CF2R antibody
    • Coagulation factor II (thrombin) receptor antibody
    • Coagulation factor II receptor antibody
    • F2R antibody
    • HTR antibody
    • PAR 1 antibody
    • PAR-1 antibody
    • PAR1 antibody
    • PAR1_HUMAN antibody
    • Protease activated receptor 1 antibody
    • Proteinase activated receptor 1 antibody
    • Proteinase-activated receptor 1 antibody
    • Thrombin receptor antibody
    • TR antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human rectum cancer tissue stained for PAR1/Thrombin Receptor using ab233741 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-PAR1/Thrombin Receptor antibody [5E2E6] (ab233741) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : PAR1/Thrombin Receptor-hIgGFc transfected HEK-293 cell lysate
  • Anti-PAR1/Thrombin Receptor antibody [5E2E6] (ab233741) at 1/500 dilution + Recombinant human PAR1/Thrombin Receptor protein

References

ab233741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up