Overview

  • Product name

  • Description

    Rabbit polyclonal to PAR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PAR2 aa 348-397.
    Sequence:

    SHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY


    Database link: P55085

  • Positive control

    • IHC-P: Human small intestine tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor for trypsin and trypsin-like enzymes coupled to G proteins that stimulate phosphoinositide hydrolysis. May have a role in the regulation of vascular tone.
  • Tissue specificity

    Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Coagulation factor II receptor like 1 antibody
    • Coagulation factor II receptor-like 1 antibody
    • Coagulation factor II thrombin receptor like 1 antibody
    • F2RL1 antibody
    • G protein coupled receptor 11 antibody
    • G-protein coupled receptor 11 antibody
    • GPR11 antibody
    • PAR 2 antibody
    • PAR-2 antibody
    • PAR2_HUMAN antibody
    • Protease activated receptor 2 antibody
    • Proteinase activated receptor 2 antibody
    • Proteinase-activated receptor 2 antibody
    • Thrombin receptor like 1 antibody
    • Thrombin receptor-like 1 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for PAR2 using ab236281 at 1/100 dilution in imunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells labeling PAR2 using ab236281 at 1/100 dilution in ICC/IF. Secondary antibody was Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up