For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    parathyroid-hormone-antibody-ab40630.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones Hormones
Share by email

Anti-Parathyroid Hormone antibody (ab40630)

  • Datasheet
Submit a review Q&A (8)References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Parathyroid Hormone antibody (ab40630)

    Key features and details

    • Rabbit polyclonal to Parathyroid Hormone
    • Suitable for: WB, IHC-FoFr
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Conjugation
    Product image
    Alkaline phosphatase Conjugation Kit - Lightning-Link® (ab102850)
    Primary
    Product image
    Anti-Dynamin 1 antibody (ab108458)
    ELISA
    Phosphate Buffered Saline (PBS) Casein ELISA Reagent (ab171532)

    View more associated products

    Overview

    • Product name

      Anti-Parathyroid Hormone antibody
      See all Parathyroid Hormone primary antibodies
    • Description

      Rabbit polyclonal to Parathyroid Hormone
    • Host species

      Rabbit
    • Tested Applications & Species

      Application Species
      WB
      Human
      See all applications and species data
    • Immunogen

      Synthetic peptide corresponding to Human Parathyroid Hormone aa 32-65.
      Sequence:

      SVSEIQLMHN LGKHLNSMER VEWLRKKLQD VHNF


      Database link: P01270
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
    • Storage buffer

      Constituents: 0.01% BSA, PBS
    • Concentration information loading...
    • Purity

      Whole antiserum
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Growth Factors/Hormones
      • Hormones

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Recombinant Protein

      • Recombinant Human Parathyroid Hormone protein (ab51234)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab40630 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Guaranteed

    Tested applications are guaranteed to work and covered by our Abpromise guarantee.

    Predicted

    Predicted to work for this combination of applications and species but not guaranteed.

    Incompatible

    Does not work for this combination of applications and species.

    Application Species
    WB
    Human
    All applications
    Cynomolgus monkey
    Application Abreviews Notes
    WB
    Use at an assay dependent concentration. Predicted molecular weight: 13 kDa. Blocking with 5% goat or donkey serum significantly reduces background as compared to BSA or milk.
    IHC-FoFr
    Use at an assay dependent concentration.
    Notes
    WB
    Use at an assay dependent concentration. Predicted molecular weight: 13 kDa. Blocking with 5% goat or donkey serum significantly reduces background as compared to BSA or milk.
    IHC-FoFr
    Use at an assay dependent concentration.

    Target

    • Function

      PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
    • Involvement in disease

      Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
    • Sequence similarities

      Belongs to the parathyroid hormone family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P01270 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 5741 Human
      • Omim: 168450 Human
      • SwissProt: P01270 Human
      • Unigene: 37045 Human
      • Alternative names

        • hPTH antibody
        • Parathormone antibody
        • Parathyrin antibody
        • Parathyroid hormone 1 antibody
        • Parathyroid hormone antibody
        • Prepro PTH antibody
        • Preproparathyroid hormone antibody
        • PTH antibody
        • PTH1 antibody
        • PTH1 receptor antibody
        • PTH1R antibody
        • PTHR antibody
        • PTHR1 antibody
        • PTHY_HUMAN antibody
        see all

      Images

      • Western blot - Anti-Parathyroid Hormone antibody (ab40630)
        Western blot - Anti-Parathyroid Hormone antibody (ab40630)

      Protocols

      • Immunohistochemistry protocols
      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (1)

      Publishing research using ab40630? Please let us know so that we can cite the reference in this datasheet.

      ab40630 has been referenced in 1 publication.

      • Cao C  et al. An unusual mediastinal parathyroid carcinoma coproducing PTH and PTHrP: A case report. Oncol Lett 11:4113-4116 (2016). PubMed: 27313750

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      1-8 of 8 Abreviews or Q&A

      Question

      I would like to know the volume and concentration of this antibody ?

      Read More

      Abcam community

      Verified customer

      Asked on Aug 01 2013

      Answer



      Unfortunately, ab15054 is an unpurified antibody (provided as whole antiserum). We can only provide concentrations for purified antibodies as unpurified antibody preparations vary significantly in specific antibody concentration.

      Nevertheless, I recommend you having a look at our website FAQs, were you could find a guideline for concentration estimation, depending on the application you are using the antibody for. You will find this valuable information at:

      https://www.abcam.com/index.html?pageconfig=technicalfaqs#8

      Read More

      Ariana Veiga

      Abcam Scientific Support

      Answered on Aug 01 2013

      Question

      In the product information of ab53040, the exactly description of the inmunogen is: Synthetic peptide derived from human Parathyroid.
      Taking in account that in the inmunogen description in ab40630 describes exactly the sequence of the synthetic peptide, we asume that if no aminoacid sequence is described, the inmunogen is the total protein.
      For future antibodies we will ask before buying them, the sequence of the inmunogen.
      Thanks.
      Regards.

      Read More

      Abcam community

      Verified customer

      Asked on Oct 31 2012

      Answer

      Thank you for your email.

      We generally add the location of immunogen e.g. N-terminal, C-terminal or internal on datasheet however I do agree this wasn't the case for this ab53040. This antibody would pick up the whole PTH but not 1-34 aa peptide.

      Could you please update me with the results you get after trying these abs with positive control?

      Thank you very much for your cooperation; I will look forward to hearing from you soon.

      Read More

      Abcam Scientific Support

      Answered on Oct 31 2012

      Question

      To whom it may concern:

      I have two antibodies against human PTH from Abcam :

      ab53040
      ab40630

      and I´m using them in Western Blot and Dot Blot assays
      to identify PTH (1-34), this means a protein with only the first 34 aminoacids
      of this hormone.

      The two mentioned antibodies are polyclonal but they don´t work:
      They don´t identify the PTH (1-34), a protein of only 4 KDa.

      Could you please help us with this issue ?

      Is it possible that the Antibodies don´t identify PTH because is only a part of the hole protein
      although both of them are polyclonal rainsed against a synthetic peptide corresponding
      to aminoacids 1-34 of PTH and a synthetic peptide derived from PTH ?

      Thanks.

      Read More

      Abcam community

      Verified customer

      Asked on Oct 30 2012

      Answer

      Thank you for your email.

      The immunogen of antibody ab53040 is a sequence from amino acid 71 to aa 100 which might be the reason this antibody is not detecting band of interest.

      ab40630 is indeed tested for 100% reactivity with 1-34 peptide so this ab should work. Could you optimize the protocol by changing dilutions/ concentration of antibody? A positive control e.g PTH protein is also recommended for comparison - this will help to check the cause of this problem.

      In order to understand the problem further I would like to know the origin of 1-34 peptide. Is it a synthetic peptide? Is its pure protein/ peptide? Could you send us the protocol details by filling the attached questionnaire?

      I will look forward to hearing from you soon.

      Read More

      Abcam Scientific Support

      Answered on Oct 30 2012

      Question

      Ich habe aber noch eine Frage. Können Sie mir auch mitteilen, was für die Immunisierung als Carrier verwendet worden ist.

      Read More

      Abcam community

      Verified customer

      Asked on Sep 05 2012

      Answer



      Hier die Antwort aus dem Labor: The carrier protein used was bovine thyroglobulin.

      Read More

      Abcam Scientific Support

      Answered on Sep 05 2012

      Question

      vielen Dank für Ihre Antwort. Ich habe allerdings noch ein paar Anmerkungen.



      a) Die unten abgebildete Sequenz entspricht den AS 1-34 des humanen PTH, nicht den AS 32-66 (vermutlich sind es die AS 32-66 des Prepro-PTH)

      b) Ich habe gerade versucht, mir das korrigierte Datenblatt runterzuladen – leider ist auf Ihrer Internetseite immer noch das alte zu sehen. Wann wird es aktualisiert?

      Read More

      Abcam community

      Verified customer

      Asked on Aug 31 2012

      Answer

      Vielen Dank für Ihre Email.



      Bezüglich der Immunogen Sequenz möchte ich bemerken, dass wir immer von der Proprotein Sequenz ausgehen.

      Eigentlich sollte das Datenblatt nach 24h aktualisiert gewesen sein... das IT Team hat mir versichert, dass spätestens ab Montag die aktualisierte Form vorliegen wird.

      Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

      Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
      https://www.abcam.com/abreviews

      Read More

      Abcam Scientific Support

      Answered on Aug 31 2012

      Question

      Sehr geehrte Damen und Herren,



      ich habe eine Frage bezüglich des Anti-Parathyroid Hormon Antikörpers (ab40630).



      In dem Datasheet steht, dass es sich bei dem Antigen um die Aminosäuren 1-34 des Humanen Parathyroid Hormons handelt.

      Die Sequenz, die da abgebildet ist, entspricht allerdings den Aminosäuren 1-34 des Humanen Parathyroid Preprohormons (die 34 Aminosäuren entsprechen quasi vollständig dem Preprohormon).

      Außerdem ist dort eine Carriersequenz abgebildet, die auch den ersten 34 Aminosäuren des Humanen Parathyroid Preprohormons entspricht.



      Das ist etwas verwirrend!

      Können Sie mir bitte noch mal genau angeben, welches die Aminosäuresequenzs des Immunogens ist und welches die Aminosäuresequenz des Carriers ist.



      Vielen Dank im Voraus und viele Grüße,

      Read More

      Abcam community

      Verified customer

      Asked on Aug 30 2012

      Answer

      Vielen Dank für Ihre Anfrage.

      Wir haben das Datenblatt nun korrigiert: Es handelt sich wirklich um das reife Protein, nicht um das
      Preprohormon.

      Die Sequenz lautet: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (AS 32-66)

      Vielen Dank, dass Sie uns auf diesen Fehler aufmerksam gemacht haben!


      Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

      Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
      https://www.abcam.com/abreviews

      Read More

      Abcam Scientific Support

      Answered on Aug 30 2012

      Question

      Dear Sir or Madam,



      can you please tell me the state of my request. I have been waiting about 3 weeks for an answer on this. Otherwise we cannot use your antibody anymore.



      My request was:



      I have a question regarding the anti-parathroid hormone (PTH) antibody (ab40630).

      In your datasheet it is stated that the antigen is PTH(1-34).

      But the sequence that you show is actually not PTH(1-34), but the first 34 aa of the prepro-parathyroid-hormone (this aa nearly fully comply with the propro-hormon part).

      Furthermore a carrier sequence is shown that is identical with the propro-hormon part – I think, this is cannot be correct.



      This is confusing.

      Can you please tell me the actual amino acid sequence of the antigen and the respective carrier.



      Thank you very much!

      Read More

      Abcam community

      Verified customer

      Asked on Aug 27 2012

      Answer

      Vielen Dank für Ihre Anfrage.

      Ich möchte Sie hiermit wissen lassen, dass ich noch an Ihrer Anfrage arbeite. Ich habe mich mit dem Labor, welches den Antikörper herstellt in Verbindung gesetzt, warte aber immer noch auf eine Antwort. Ich werde mich wieder bei Ihnen melden, sobald ich diese bekommen habe.

      Bitte entschuldigen Sie die Verzögerung und vielen Dank für Ihre Geduld.

      Read More

      Abcam Scientific Support

      Answered on Aug 27 2012

      Question

      Hi, Could you please confirm if the concentration of 1.00 mg/mL indicated on the data sheet for the Rabbit anti-PTH catalogue number ab40630 corresponds to the concentration of anti-PTH antibodies in the whole antiserum. Thank you,  

      Read More

      Abcam community

      Verified customer

      Asked on Oct 11 2011

      Answer

      Thank you for contacting Abcam about ab40630. I have contacted the laboratory to clarify the concentration of the antibody and they have stated that the product is at 1mg/ml of "neat" rabbit antiserum. If there is anything else I can do to be of assistance, please do not hesitate to contact me.

      Read More

      Abcam Scientific Support

      Answered on Oct 11 2011

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.