Anti-Parathyroid Hormone antibody (ab40630)

Submit a review Q&A (8)References (1)

Overview

  • Product name
    Anti-Parathyroid Hormone antibody
    See all Parathyroid Hormone primary antibodies
  • Description
    Rabbit polyclonal to Parathyroid Hormone
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, RIA, ICC, IHC-FoFrmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human Parathyroid Hormone aa 32-65.
    Sequence:

    SVSEIQLMHN LGKHLNSMER VEWLRKKLQD VHNF


    Database link: P01270

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 0.01% BSA, PBS
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab40630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 13 kDa. Blocking with 5% goat or donkey serum significantly reduces background as compared to BSA or milk.
RIA 1/12000.
ICC 1/500.
IHC-FoFr Use at an assay dependent concentration.

Target

  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
    • Alternative names
      • hPTH antibody
      • Parathormone antibody
      • Parathyrin antibody
      • Parathyroid hormone 1 antibody
      • Parathyroid hormone antibody
      • Prepro PTH antibody
      • Preproparathyroid hormone antibody
      • PTH antibody
      • PTH1 antibody
      • PTH1 receptor antibody
      • PTH1R antibody
      • PTHR antibody
      • PTHR1 antibody
      • PTHY_HUMAN antibody
      see all

    References

    This product has been referenced in:
    • Cao C  et al. An unusual mediastinal parathyroid carcinoma coproducing PTH and PTHrP: A case report. Oncol Lett 11:4113-4116 (2016). Read more (PubMed: 27313750) »
    See 1 Publication for this product

    Publishing research using ab40630? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-8 of 8 Abreviews or Q&A

    Question

    I would like to know the volume and concentration of this antibody ?

    Read More
    Answer



    Unfortunately, ab15054 is an unpurified antibody (provided as whole antiserum). We can only provide concentrations for purified antibodies as unpurified antibody preparations vary significantly in specific antibody concentration.

    Nevertheless, I recommend you having a look at our website FAQs, were you could find a guideline for concentration estimation, depending on the application you are using the antibody for. You will find this valuable information at:

    https://www.abcam.com/index.html?pageconfig=technicalfaqs#8

    Read More

    Question

    In the product information of ab53040, the exactly description of the inmunogen is: Synthetic peptide derived from human Parathyroid.
    Taking in account that in the inmunogen description in ab40630 describes exactly the sequence of the synthetic peptide, we asume that if no aminoacid sequence is described, the inmunogen is the total protein.
    For future antibodies we will ask before buying them, the sequence of the inmunogen.
    Thanks.
    Regards.

    Read More
    Answer

    Thank you for your email.

    We generally add the location of immunogen e.g. N-terminal, C-terminal or internal on datasheet however I do agree this wasn't the case for this ab53040. This antibody would pick up the whole PTH but not 1-34 aa peptide.

    Could you please update me with the results you get after trying these abs with positive control?

    Thank you very much for your cooperation; I will look forward to hearing from you soon.

    Read More

    Question

    To whom it may concern:

    I have two antibodies against human PTH from Abcam :

    ab53040
    ab40630

    and I´m using them in Western Blot and Dot Blot assays
    to identify PTH (1-34), this means a protein with only the first 34 aminoacids
    of this hormone.

    The two mentioned antibodies are polyclonal but they don´t work:
    They don´t identify the PTH (1-34), a protein of only 4 KDa.

    Could you please help us with this issue ?

    Is it possible that the Antibodies don´t identify PTH because is only a part of the hole protein
    although both of them are polyclonal rainsed against a synthetic peptide corresponding
    to aminoacids 1-34 of PTH and a synthetic peptide derived from PTH ?

    Thanks.

    Read More
    Answer

    Thank you for your email.

    The immunogen of antibody ab53040 is a sequence from amino acid 71 to aa 100 which might be the reason this antibody is not detecting band of interest.

    ab40630 is indeed tested for 100% reactivity with 1-34 peptide so this ab should work. Could you optimize the protocol by changing dilutions/ concentration of antibody? A positive control e.g PTH protein is also recommended for comparison - this will help to check the cause of this problem.

    In order to understand the problem further I would like to know the origin of 1-34 peptide. Is it a synthetic peptide? Is its pure protein/ peptide? Could you send us the protocol details by filling the attached questionnaire?

    I will look forward to hearing from you soon.

    Read More

    Question

    Ich habe aber noch eine Frage. Können Sie mir auch mitteilen, was für die Immunisierung als Carrier verwendet worden ist.

    Read More
    Answer



    Hier die Antwort aus dem Labor: The carrier protein used was bovine thyroglobulin.

    Read More

    Question

    vielen Dank für Ihre Antwort. Ich habe allerdings noch ein paar Anmerkungen.



    a) Die unten abgebildete Sequenz entspricht den AS 1-34 des humanen PTH, nicht den AS 32-66 (vermutlich sind es die AS 32-66 des Prepro-PTH)

    b) Ich habe gerade versucht, mir das korrigierte Datenblatt runterzuladen – leider ist auf Ihrer Internetseite immer noch das alte zu sehen. Wann wird es aktualisiert?

    Read More
    Answer

    Vielen Dank für Ihre Email.



    Bezüglich der Immunogen Sequenz möchte ich bemerken, dass wir immer von der Proprotein Sequenz ausgehen.

    Eigentlich sollte das Datenblatt nach 24h aktualisiert gewesen sein... das IT Team hat mir versichert, dass spätestens ab Montag die aktualisierte Form vorliegen wird.

    Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

    Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
    https://www.abcam.com/abreviews

    Read More

    Question

    Sehr geehrte Damen und Herren,



    ich habe eine Frage bezüglich des Anti-Parathyroid Hormon Antikörpers (ab40630).



    In dem Datasheet steht, dass es sich bei dem Antigen um die Aminosäuren 1-34 des Humanen Parathyroid Hormons handelt.

    Die Sequenz, die da abgebildet ist, entspricht allerdings den Aminosäuren 1-34 des Humanen Parathyroid Preprohormons (die 34 Aminosäuren entsprechen quasi vollständig dem Preprohormon).

    Außerdem ist dort eine Carriersequenz abgebildet, die auch den ersten 34 Aminosäuren des Humanen Parathyroid Preprohormons entspricht.



    Das ist etwas verwirrend!

    Können Sie mir bitte noch mal genau angeben, welches die Aminosäuresequenzs des Immunogens ist und welches die Aminosäuresequenz des Carriers ist.



    Vielen Dank im Voraus und viele Grüße,

    Read More
    Answer

    Vielen Dank für Ihre Anfrage.

    Wir haben das Datenblatt nun korrigiert: Es handelt sich wirklich um das reife Protein, nicht um das
    Preprohormon.

    Die Sequenz lautet: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (AS 32-66)

    Vielen Dank, dass Sie uns auf diesen Fehler aufmerksam gemacht haben!


    Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

    Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
    https://www.abcam.com/abreviews

    Read More

    Question

    Dear Sir or Madam,



    can you please tell me the state of my request. I have been waiting about 3 weeks for an answer on this. Otherwise we cannot use your antibody anymore.



    My request was:



    I have a question regarding the anti-parathroid hormone (PTH) antibody (ab40630).

    In your datasheet it is stated that the antigen is PTH(1-34).

    But the sequence that you show is actually not PTH(1-34), but the first 34 aa of the prepro-parathyroid-hormone (this aa nearly fully comply with the propro-hormon part).

    Furthermore a carrier sequence is shown that is identical with the propro-hormon part – I think, this is cannot be correct.



    This is confusing.

    Can you please tell me the actual amino acid sequence of the antigen and the respective carrier.



    Thank you very much!

    Read More
    Answer

    Vielen Dank für Ihre Anfrage.

    Ich möchte Sie hiermit wissen lassen, dass ich noch an Ihrer Anfrage arbeite. Ich habe mich mit dem Labor, welches den Antikörper herstellt in Verbindung gesetzt, warte aber immer noch auf eine Antwort. Ich werde mich wieder bei Ihnen melden, sobald ich diese bekommen habe.

    Bitte entschuldigen Sie die Verzögerung und vielen Dank für Ihre Geduld.

    Read More

    Question

    Hi, Could you please confirm if the concentration of 1.00 mg/mL indicated on the data sheet for the Rabbit anti-PTH catalogue number ab40630 corresponds to the concentration of anti-PTH antibodies in the whole antiserum. Thank you,  

    Read More
    Answer

    Thank you for contacting Abcam about ab40630. I have contacted the laboratory to clarify the concentration of the antibody and they have stated that the product is at 1mg/ml of "neat" rabbit antiserum. If there is anything else I can do to be of assistance, please do not hesitate to contact me.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up