Overview

  • Product name
    Anti-Parathyroid Hormone antibody
    See all Parathyroid Hormone primary antibodies
  • Description
    Rabbit polyclonal to Parathyroid Hormone
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, RIA, ICC, IHC-FoFrmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human Parathyroid Hormone aa 32-65.
    Sequence:

    SVSEIQLMHN LGKHLNSMER VEWLRKKLQD VHNF


    Database link: P01270

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 0.01% BSA, PBS
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab40630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 13 kDa. Blocking with 5% goat or donkey serum significantly reduces background as compared to BSA or milk.
RIA 1/12000.
ICC 1/500.
IHC-FoFr Use at an assay dependent concentration.

Target

  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • hPTH antibody
    • Parathormone antibody
    • Parathyrin antibody
    • Parathyroid hormone 1 antibody
    • Parathyroid hormone antibody
    • Prepro PTH antibody
    • Preproparathyroid hormone antibody
    • PTH antibody
    • PTH1 antibody
    • PTH1 receptor antibody
    • PTH1R antibody
    • PTHR antibody
    • PTHR1 antibody
    • PTHY_HUMAN antibody
    see all

References

This product has been referenced in:
  • Cao C  et al. An unusual mediastinal parathyroid carcinoma coproducing PTH and PTHrP: A case report. Oncol Lett 11:4113-4116 (2016). Read more (PubMed: 27313750) »
See 1 Publication for this product

Customer reviews and Q&As

1-8 of 8 Abreviews or Q&A

Question
Answer



Unfortunately, ab15054 is an unpurified antibody (provided as whole antiserum). We can only provide concentrations for purified antibodies as unpurified antibody preparations vary significantly in specific antibody concentration.

Nevertheless, I recommend you having a look at our website FAQs, were you could find a guideline for concentration estimation, depending on the application you are using the antibody for. You will find this valuable information at:

https://www.abcam.com/index.html?pageconfig=technicalfaqs#8

Read More

Answer

Thank you for your email.

We generally add the location of immunogen e.g. N-terminal, C-terminal or internal on datasheet however I do agree this wasn't the case for this ab53040. This antibody would pick up the whole PTH but not 1-34 aa peptide.

Could you please update me with the results you get after trying these abs with positive control?

Thank you very much for your cooperation; I will look forward to hearing from you soon.

Read More

Answer

Thank you for your email.

The immunogen of antibody ab53040 is a sequence from amino acid 71 to aa 100 which might be the reason this antibody is not detecting band of interest.

ab40630 is indeed tested for 100% reactivity with 1-34 peptide so this ab should work. Could you optimize the protocol by changing dilutions/ concentration of antibody? A positive control e.g PTH protein is also recommended for comparison - this will help to check the cause of this problem.

In order to understand the problem further I would like to know the origin of 1-34 peptide. Is it a synthetic peptide? Is its pure protein/ peptide? Could you send us the protocol details by filling the attached questionnaire?

I will look forward to hearing from you soon.

Read More

Answer



Hier die Antwort aus dem Labor: The carrier protein used was bovine thyroglobulin.

Read More

Answer

Vielen Dank für Ihre Email.



Bezüglich der Immunogen Sequenz möchte ich bemerken, dass wir immer von der Proprotein Sequenz ausgehen.

Eigentlich sollte das Datenblatt nach 24h aktualisiert gewesen sein... das IT Team hat mir versichert, dass spätestens ab Montag die aktualisierte Form vorliegen wird.

Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
https://www.abcam.com/abreviews

Read More

Answer

Vielen Dank für Ihre Anfrage.

Wir haben das Datenblatt nun korrigiert: Es handelt sich wirklich um das reife Protein, nicht um das
Preprohormon.

Die Sequenz lautet: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (AS 32-66)

Vielen Dank, dass Sie uns auf diesen Fehler aufmerksam gemacht haben!


Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
https://www.abcam.com/abreviews

Read More

Answer

Thank you for contacting Abcam about ab40630. I have contacted the laboratory to clarify the concentration of the antibody and they have stated that the product is at 1mg/ml of "neat" rabbit antiserum. If there is anything else I can do to be of assistance, please do not hesitate to contact me.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up