Overview

  • Product name
    Anti-Parathyroid Hormone antibody
    See all Parathyroid Hormone primary antibodies
  • Description
    Rabbit polyclonal to Parathyroid Hormone
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, RIA, ICC, IHC-FoFrmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human Parathyroid Hormone aa 32-65.
    Sequence:

    SVSEIQLMHN LGKHLNSMER VEWLRKKLQD VHNF


    Database link: P01270

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: None
    Constituents: 0.01% BSA, PBS
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab40630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 13 kDa. Blocking with 5% goat or donkey serum significantly reduces background as compared to BSA or milk.
RIA 1/12000.
ICC 1/500.
IHC-FoFr Use at an assay dependent concentration.

Target

  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
    • Alternative names
      • hPTH antibody
      • Parathormone antibody
      • Parathyrin antibody
      • Parathyroid hormone 1 antibody
      • Parathyroid hormone antibody
      • Prepro PTH antibody
      • Preproparathyroid hormone antibody
      • PTH antibody
      • PTH1 antibody
      • PTH1 receptor antibody
      • PTH1R antibody
      • PTHR antibody
      • PTHR1 antibody
      • PTHY_HUMAN antibody
      see all

    References

    This product has been referenced in:
    • Cao C  et al. An unusual mediastinal parathyroid carcinoma coproducing PTH and PTHrP: A case report. Oncol Lett 11:4113-4116 (2016). Read more (PubMed: 27313750) »

    See 1 Publication for this product

    Publishing research using ab40630? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Submit a review Submit a question

    8 reviews or Q&A

    10
    Votes: Highest First

    I would like to know the volume and concentration of this antibody ?



    Unfortunately, ab15054 is an unpurified antibody (provided as whole antiserum). We can only provide concentrations for purified antibodies as unpurified antibody preparations vary significantly in specific antibody concentration.

    Ne...

    Read More

    In the product information of ab53040, the exactly description of the inmunogen is: Synthetic peptide derived from human Parathyroid.
    Taking in account that in the inmunogen description in ab40630 describes exactly the sequence of the synthetic pep...

    Read More

    Thank you for your email.

    We generally add the location of immunogen e.g. N-terminal, C-terminal or internal on datasheet however I do agree this wasn't the case for this ab53040. This antibody would pick up the whole PTH but not 1-34 aa pepti...

    Read More

    To whom it may concern:

    I have two antibodies against human PTH from Abcam :

    ab53040
    ab40630

    and I´m using them in Western Blot and Dot Blot assays
    to identify PTH (1-34), this means a protein with only the fir...

    Read More

    Thank you for your email.

    The immunogen of antibody ab53040 is a sequence from amino acid 71 to aa 100 which might be the reason this antibody is not detecting band of interest.

    ab40630 is indeed tested for 100% reactivity with 1-34 p...

    Read More

    Ich habe aber noch eine Frage. Können Sie mir auch mitteilen, was für die Immunisierung als Carrier verwendet worden ist.



    Hier die Antwort aus dem Labor: The carrier protein used was bovine thyroglobulin.

    vielen Dank für Ihre Antwort. Ich habe allerdings noch ein paar Anmerkungen.



    a) Die unten abgebildete Sequenz entspricht den AS 1-34 des humanen PTH, nicht den AS 32-66 (vermutlich sind es die AS 32-66 des Prepro-PTH)
    ...

    Read More

    Vielen Dank für Ihre Email.



    Bezüglich der Immunogen Sequenz möchte ich bemerken, dass wir immer von der Proprotein Sequenz ausgehen.

    Eigentlich sollte das Datenblatt nach 24h aktualisiert gewesen sein... d...

    Read More

    Sehr geehrte Damen und Herren,



    ich habe eine Frage bezüglich des Anti-Parathyroid Hormon Antikörpers (ab40630).



    In dem Datasheet steht, dass es sich bei dem Antigen um die Aminosäuren 1-34 de...

    Read More

    Vielen Dank für Ihre Anfrage.

    Wir haben das Datenblatt nun korrigiert: Es handelt sich wirklich um das reife Protein, nicht um das
    Preprohormon.

    Die Sequenz lautet: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (AS 32-66)

    ...

    Read More

    Dear Sir or Madam,



    can you please tell me the state of my request. I have been waiting about 3 weeks for an answer on this. Otherwise we cannot use your antibody anymore.



    My request was:


    <...

    Read More

    Vielen Dank für Ihre Anfrage.

    Ich möchte Sie hiermit wissen lassen, dass ich noch an Ihrer Anfrage arbeite. Ich habe mich mit dem Labor, welches den Antikörper herstellt in Verbindung gesetzt, warte aber immer noch auf eine Antwort. Ich werd...

    Read More

    Hi, Could you please confirm if the concentration of 1.00 mg/mL indicated on the data sheet for the Rabbit anti-PTH catalogue number ab40630 corresponds to the concentration of anti-PTH antibodies in the whole antiserum. Thank you,

    Thank you for contacting Abcam about ab40630. I have contacted the laboratory to clarify the concentration of the antibody and they have stated that the product is at 1mg/ml of "neat" rabbit antiserum. If there is anything else I can do to be of assi...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up