Anti-Parathyroid Hormone antibody [PTH/1175] - BSA and Azide free (ab212763)

Overview

  • Product name

    Anti-Parathyroid Hormone antibody [PTH/1175] - BSA and Azide free
    See all Parathyroid Hormone primary antibodies
  • Description

    Mouse monoclonal [PTH/1175] to Parathyroid Hormone - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide aa 32-115 (C terminal). The exact sequence is proprietary.
    Sequence:

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQR PRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ


    Database link: P01270

  • Positive control

    • Human parathyroid tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    PTH/1175
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab212763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease

    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities

    Belongs to the parathyroid hormone family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • hPTH antibody
    • Parathormone antibody
    • Parathyrin antibody
    • Parathyroid hormone 1 antibody
    • Parathyroid hormone antibody
    • Prepro PTH antibody
    • Preproparathyroid hormone antibody
    • PTH antibody
    • PTH1 antibody
    • PTH1 receptor antibody
    • PTH1R antibody
    • PTHR antibody
    • PTHR1 antibody
    • PTHY_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human parathyroid tissue labeling Parathyroid Hormone with ab212763 at 1 μg/ml dilution.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human parathyroid tissue labeling Parathyroid Hormone with ab212763 at 1 μg/ml dilution.

References

ab212763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up