Pardaxin, Antibacterial, apoptotic and neurotoxic ionophore (ab141838)

Overview

  • Product name

    Pardaxin, Antibacterial, apoptotic and neurotoxic ionophore
  • Description

    Antibacterial, apoptotic and neurotoxic ionophore
  • Biological description

    Antibacterial, apoptotic and neurotoxic ionophore. Forms pores on lipid membranes. Induces caspase-dependent and ROS-mediated apoptosis. Stimulates calcium-independent PLA2 release of arachidonic acid (Asc 916) and eicosanoids. Active in vivo.
  • Purity

    > 98%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    3382.00
  • Molecular formula

    C156H250N36O47
  • Sequence

    GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
  • PubChem identifier

    16143997
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one month. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • SMILES

    CCC(C)C(C(=O)NC(C(C)CC)C(=O)NC(CO)C(=O)NC(CO)C(=O)N1CCCC1C(=O)NC(CC(C)C)C(=O)NC(CC2=CC=CC=C2)C(=O)NC(CCCCN)C(=O)NC(C(C)O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NCC(=O)NC(CO)C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CO)C(=O
  • Source

    Pardachirus marmoratus

  • Research areas

References

This product has been referenced in:

  • Wu SP  et al. Pardaxin, a fish antimicrobial peptide, exhibits antitumor activity toward murine fibrosarcoma in vitro and in vivo. Mar Drugs 10:1852-72 (2012). Read more (PubMed: 23015777) »
  • Huang TC  et al. Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells. Mar Drugs 9:1995-2009 (2011). Read more (PubMed: 22073006) »
  • Bloch-Shilderman E  et al. Pardaxin, an ionophore neurotoxin, induces PC12 cell death: activation of stress kinases and production of reactive oxygen species. J Nat Toxins 11:71-85 (2002). Read more (PubMed: 12009115) »
  • Abu-Raya S  et al. Pardaxin, a new pharmacological tool to stimulate the arachidonic acid cascade in PC12 cells. J Pharmacol Exp Ther 287:889-96 (1998). Read more (PubMed: 9864269) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up