Overview

  • Product name

    Anti-PARG antibody [OTI1B5]
    See all PARG primary antibodies
  • Description

    Mouse monoclonal [OTI1B5] to PARG
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PARG aa 1-367. Produced in E.coli (NP_003622).
    Sequence:

    MNAGPGCEPCTKRPRWGAATTSPAASDARSFPSRQRRVLDPKDAHVQFRV PPSSPACVPGRAGQHRGSATSLVFKQKTITSWMDTKGIKTAESESLDSKE NNNTRIESMMSSVQKDNFYQHNVEKLENVSQLSLDKSPTEKSTQYLNQHQ TAAMCKWQNEGKHTEQLLESEPQTVTLVPEQFSNANIDRSPQNDDHSDTD SEENRDNQQFLTTVKLANAKQTTEDEQAREAKSHQKCSKSCDPGEDCASC QQDEIDVVPESPLSDVGSEDVGTGPKNDNKLTRQESCLGNSPPFEKESEP ESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDAD IEFRKRYSTKGGEVRLH


    Database link: Q86W56

  • Positive control

    • WB: pCMV6-ENTRY PARG transfected HEK-293T cell lysate. IHC-P: Human tonsil tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1B5
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 111 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120 °C for 3 minutes.

Target

  • Function

    Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism may be required for maintenance of the normal function of neuronal cells.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the poly(ADP-ribose) glycohydrolase family.
  • Cellular localization

    Cytoplasm and Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP riboseglycohydrolase antibody
    • Mitochondrial poly(ADP ribose) glycohydrolase antibody
    • Parg antibody
    • PARG_HUMAN antibody
    • PARG99 antibody
    • Poly antibody
    • poly (ADP ribose) glycohydrolase antibody
    • poly(ADP-ribose) glycohydrolase 60 kDa isoform antibody
    • Poly(ADP-ribose) glycohydrolase antibody
    see all

Images

  • All lanes : Anti-PARG antibody [OTI1B5] (ab236403) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY PARG transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 111 kDa

  • Paraffin-embedded human tonsil tissue stained for PARG using ab236403 at 1/150 dilution in immunohistochemical analysis.

References

ab236403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up