Overview

  • Product name
  • Description
    Rabbit Polyclonal to PARP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC, Neutralising, WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human, Monkey
  • Immunogen

    Full length native protein (purified) corresponding to Cow PARP1.
    Sequence:

    MAESSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMFDGKIPH WYHLSCFWKVGFSIWHPDVEVEGFSELRWDDQQTIKKMAETGGRTDVSGK GQDGVGSKTEKTLIDFGAGYAKSNRSTCKSCMEKIDKGQVRLSKKVVYPD KPQLGMVDCWYHPKCFVQKREELGFRPEFSATHLMGFSVLTAEDQETLKK QLPAIKGERKRKGDEVDGIDEVTKKKSKKEKDKEIKLEKALKAQNDLIWN VKDELKKACSTNDLKELLIFNKQEVPSGESAILDRVADGMVFGALLPCEE CSGQLVFKGDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYFKK LKIKKQDRIFPPESSTPVGAAAPPSAASAPAAVHSGPPDKPLSNMKILTL GKLSQNKDEVKATIEKLGGKLTGTANKASLCISTKKEVDKLNKKMEEVKE ANIRVVSEDFLQDISASTKSLQELLSTHLLSPWGAEVKVEPVEAVGPKGK SGAAPSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSGLEHNAHVLEK GGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGS NKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKHPKKFYPLEIDYGQD EEAVKKLTVNPGTKSKLPKPVQNLIKMIFDVESMKKAMVEYEIDLQKMPL GKLSKRQIQAAYSILSEVQQALSQGSSDSHILDLSNRFYTLIPHDFGMKK PPLLNNANSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLK TDIKVVDKDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRY KPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFA DMVSKSANYCHTSQGDPIGLILLGEAALGNMYELKHARHISKLPKGKHSV KGLGKTTPDPSASITVDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVH LKYLLKLKFNFKTSLW


    Database link: P18493

Properties

Applications

Our Abpromise guarantee covers the use of ab176491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC 1/500.

Dilution buffer: 50 mM TRIS, pH 7.5, 150 mM NaCl, 5% milk.

Neutralising Use at an assay dependent concentration.

Neutralizes the biological activity of PARP

WB 1/5000.
IP 1/50.

Dilution buffer: 175 mM sodium phosphate, pH 7.5, 100 mM NaCl, 1% Triton X100, 0.5% sodium deoxycholate, 0.1% SDS, 0.1 mM EDTA and protease inhibitors (0.17 µg/ml PMSF, 27 µg/ml aprotinin, 0.5 µg/ml leupeptin, 0.5 µg/ml pepstatin, 0.5 µg/ml chymostatin, 0.5 µg/ml tosylphenylalanine).

Target

  • Function
    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. Mediates the poly(ADP-ribosyl)ation of APLF and CHFR. Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150.
  • Sequence similarities
    Contains 1 BRCT domain.
    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
    Contains 2 PARP-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated by PRKDC. Phosphorylated upon DNA damage, probably by ATM or ATR.
    Poly-ADP-ribosylated by PARP2. Poly-ADP-ribosylation mediates the recruitment of CHD1L to DNA damage sites.
    S-nitrosylated, leading to inhibit transcription regulation activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase) antibody
    • ADP ribosyltransferase antibody
    • ADP ribosyltransferase diphtheria toxin like 1 antibody
    • ADP ribosyltransferase NAD(+) antibody
    • ADPRT 1 antibody
    • ADPRT antibody
    • ADPRT1 antibody
    • ARTD1 antibody
    • msPARP antibody
    • NAD(+) ADP ribosyltransferase 1 antibody
    • NAD(+) ADP-ribosyltransferase 1 antibody
    • pADPRT 1 antibody
    • pADPRT1 antibody
    • PARP 1 antibody
    • PARP antibody
    • PARP-1 antibody
    • PARP1 antibody
    • PARP1_HUMAN antibody
    • Poly (ADP ribose) polymerase 1 antibody
    • poly (ADP ribose) polymerase family, member 1 antibody
    • Poly [ADP-ribose] polymerase 1 antibody
    • Poly(ADP ribose) polymerase antibody
    • poly(ADP ribose) synthetase antibody
    • poly(ADP ribosyl)transferase antibody
    • Poly[ADP ribose] synthetase 1 antibody
    • Poly[ADP-ribose] synthase 1 antibody
    • PPOL antibody
    see all

References

ab176491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up