Overview

  • Product name

  • Description

    Rabbit polyclonal to PARP3/IRT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PARP3/IRT1 aa 11-56. The exact sequence is proprietary.
    Sequence:

    TEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSS


    Database link: Q9Y6F1

  • Positive control

    • HEK293T, Raw264.7 and H9C2 whole cell lysates.
  • General notes

    Protein previously labeled as PARP3.

Properties

Applications

Our Abpromise guarantee covers the use of ab201099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 60 kDa.

Target

  • Function

    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. May link the DNA damage surveillance network to the mitotic fidelity checkpoint. Negatively influences the G1/S cell cycle progression without interfering with centrosome duplication. Binds DNA. May be involved in the regulation of PRC2 and PRC3 complex-dependent gene silencing.
  • Tissue specificity

    Widely expressed; the highest levels are in the kidney, skeletal muscle, liver, heart and spleen; also detected in pancreas, lung, placenta, brain, leukocytes, colon, small intestine, ovary, testis, prostate and thymus.
  • Sequence similarities

    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
  • Domain

    According to PubMed:10329013, the N-terminal domain (54 amino acids) of isoform 2 is responsible for its centrosomal localization. The C-terminal region contains the catalytic domain.
  • Post-translational
    modifications

    Auto-poly(ADP)-ribosylation.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > centrosome > centriole. Core component of the centrosome. Preferentially localized to the daughter centriole throughout the cell cycle. According to PubMed:16924674, it is almost exclusively localized in the nucleus and appears in numerous small foci and a small number of larger foci whereas a centrosomal location has not been detected.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP ribosyltransferase (NAD+; poly (ADP ribose) antibody
    • ADP ribosyltransferase diphtheria toxin like 3 antibody
    • ADPRT-3 antibody
    • ADPRT3 antibody
    • ADPRTL2 antibody
    • ADPRTL3 antibody
    • ARTD3 antibody
    • hPARP 3 antibody
    • hPARP-3 antibody
    • hPARP3 antibody
    • IRT 1 antibody
    • IRT1 antibody
    • NAD(+) ADP ribosyltransferase 3 antibody
    • NAD(+) ADP-ribosyltransferase 3 antibody
    • NAD+ ADP ribosyltransferase 3 antibody
    • pADPRT 3 antibody
    • pADPRT-3 antibody
    • pADPRT3 antibody
    • PARP 3 antibody
    • PARP-3 antibody
    • PARP3 antibody
    • PARP3_HUMAN antibody
    • Poly (ADP ribose) polymerase family, member 3 antibody
    • Poly (ADP ribose) synthetase 3 antibody
    • Poly [ADP-ribose] polymerase 3 antibody
    • Poly[ADP ribose] synthetase 3 antibody
    • Poly[ADP-ribose] synthase 3 antibody
    see all

Images

  • All lanes : Anti-PARP3/IRT1 antibody (ab201099)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 60 kDa

References

ab201099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201099.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up