Overview

  • Product name

  • Description

    Rabbit polyclonal to PARVA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PARVA aa 2-94.
    Sequence:

    ATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQE EGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKL


    Database link: Q9NVD7

  • Positive control

    • IHC-P: Human pancreas tissue. ICC/IF: A549 cells.
  • General notes

     This product was previously labelled as Parvin alpha

     

Properties

Applications

Our Abpromise guarantee covers the use of ab237683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Probably plays a role in the regulation of cell adhesion and cytoskeleton organization. Plays a role in ciliogenesis.
  • Tissue specificity

    Widely expressed, with highest levels in heart, skeletal muscle, kidney and liver.
  • Sequence similarities

    Belongs to the parvin family.
    Contains 2 CH (calponin-homology) domains.
  • Cellular localization

    Cell junction > focal adhesion. Cell membrane. Cytoplasm > cytoskeleton. Constituent of focal adhesions.
  • Information by UniProt
  • Database links

  • Alternative names

    • Actopaxin antibody
    • Alpha parvin antibody
    • Alpha-parvin antibody
    • Calponin like integrin linked kinase binding protein antibody
    • Calponin-like integrin-linked kinase-binding protein antibody
    • CH ILKBP antibody
    • CH-ILKBP antibody
    • FLJ10793 antibody
    • FLJ12254 antibody
    • Matrix remodelling associated 2 antibody
    • Matrix remodelling associated protein 2 antibody
    • Matrix-remodeling-associated protein 2 antibody
    • MXRA 2 antibody
    • MXRA2 antibody
    • PARV A antibody
    • Parva antibody
    • PARVA_HUMAN antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for PARVA using ab237683 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for PARVA (green) using ab237683 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab237683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up