Overview

  • Product name

  • Description

    Rabbit polyclonal to PASD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PASD1 aa 322-464.
    Sequence:

    QQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQPSSPVAYDIIS QELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVVI PDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSL


    Database link: Q8IV76

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May function as a transcription factor.
  • Tissue specificity

    Testis-specific. Found in histologically normal tissues from patients with uterus, lung and small intestine cancers. Widespread expression seen in solid tumors and diffuse large B-cell lymphoma (DLBCL)-derived cell lines. Isoform 2 is expressed in all DLBCL-derived cell lines, while isoform 1 is preferentially expressed in cell lines derived from non-germinal center DLBCL.
  • Sequence similarities

    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 63 antibody
    • CT63 antibody
    • OX-TES-1 antibody
    • PAS domain containing 1 antibody
    • PAS domain-containing protein 1 antibody
    • PASD1 antibody
    • PASD1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for PASD1 with ab224362 (1/200) in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for PASD1 (green) using ab224362 (4 µg/ml) in ICC/IF.

References

ab224362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up