Anti-PASD1 antibody (ab224363)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PASD1 antibody
See all PASD1 primary antibodies -
Description
Rabbit polyclonal to PASD1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PASD1 aa 84-231.
Sequence:EEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVEHGDSSAYENVKFIVN VRDICNEFPVVFSGLFSSHLCADFAACVPQEDRLYLVGNVCILRTQLLQQ LYTSKAVSDEAVLTQDSDEEPFVGELSSSQGQRGHTSMKAVYVEPAAA
Database link: Q8IV76 -
Positive control
- IHC: Human testis tissue. ICC/IF: PC-3 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224363 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May function as a transcription factor. -
Tissue specificity
Testis-specific. Found in histologically normal tissues from patients with uterus, lung and small intestine cancers. Widespread expression seen in solid tumors and diffuse large B-cell lymphoma (DLBCL)-derived cell lines. Isoform 2 is expressed in all DLBCL-derived cell lines, while isoform 1 is preferentially expressed in cell lines derived from non-germinal center DLBCL. -
Sequence similarities
Contains 1 PAS (PER-ARNT-SIM) domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 139135 Human
- SwissProt: Q8IV76 Human
- Unigene: 160594 Human
-
Alternative names
- Cancer/testis antigen 63 antibody
- CT63 antibody
- OX-TES-1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PASD1 antibody (ab224363)
Paraffin-embedded human testis tissue stained for PASD1 with ab224363 (1/200) in immunohistochemical analysis.
-
PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for PASD1 (green) using ab224363 (4 µg/ml) in ICC/IF.
Datasheets and documents
References
ab224363 has not yet been referenced specifically in any publications.