Overview

  • Product name

    Anti-PAWP antibody
  • Description

    Rabbit polyclonal to PAWP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PAWP aa 65-290.
    Sequence:

    SISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFK LVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMC TPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASP VRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPA GNEGPPAGYRASPAGSGARPHESTAA


    Database link: BC022546

  • Positive control

    • Human fetal stomach tissue lysate; Human fetal testis tissue
  • General notes

     This product was previously labelled as WBP2NL

     

Properties

  • Form

    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab170115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 32 kDa.

Target

  • Relevance

    WBP2NL is a sperm specific WW domain binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization.
  • Database links

  • Alternative names

    • FLJ26145 antibody
    • MGC26816 antibody
    • OTTHUMP00000028745 antibody
    • PAWP antibody
    • Postacrosomal sheath WW domain binding protein antibody
    • WBP2 N terminal like antibody
    • WBP2 NL antibody
    • WW domain binding protein 2 like antibody
    see all

Images

  • Anti-PAWP antibody (ab170115) at 1/500 dilution + Human fetal stomach lysate

    Predicted band size: 32 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal testis tissue labeling PAWP with ab170115 at 1/100.

References

This product has been referenced in:

  • Freour T  et al. WBP2NL/PAWP mRNA and protein expression in sperm cells are not related to semen parameters, fertilization rate, or reproductive outcome. J Assist Reprod Genet 34:803-810 (2017). Read more (PubMed: 28444612) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up