Overview

  • Product name

  • Description

    Rabbit polyclonal to PAX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PAX1 aa 150-200 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    ILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDR L


    Database link: P15863

  • Positive control

    • Human gastric cancer and mouse tumor tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 55 kDa.

Target

Images

  • Immunohistochemical analysis of formalin fixed and paraffin embedded mouse tumor tissue labeling PAX1 using ab203064 at 1/200 dilution. DAB staining.

  • Immunohistochemical analysis of formalin fixed and paraffin embedded human gastric cancer tissue labeling PAX1 using ab203064 at 1/200 dilution. DAB staining.

References

ab203065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up