Overview

  • Product name

    Anti-PAX7 antibody [PAX7497]
    See all PAX7 primary antibodies
  • Description

    Mouse monoclonal [PAX7497] to PAX7
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Fr, Flow Cyt, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Chicken, Human, Zebrafish
  • Immunogen

    Recombinant full length protein corresponding to Human PAX7 aa 1-520.
    Sequence:

    MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRP LPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGA IGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPS GLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLD EGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREEL AQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTL PPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSS AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQP QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT GYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSG WGMSISQMEKLKSSQMEQFT


    Database link: P23759

  • Positive control

    • HeLa, Jurkat, A431, MCF-7, U2OS and NIH/3T3 cells. Stomach or rhabdomyosarcoma.

Properties

Applications

Our Abpromise guarantee covers the use of ab199010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 57 kDa.
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IP Use at 1-2 µg/mg of lysate.

Target

  • Function

    Probable transcription factor. May have a role in myogenesis.
  • Involvement in disease

    Defects in PAX7 are a cause of rhabdomyosarcoma type 2 (RMS2) [MIM:268220]. It is a form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchimal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. Note=A chromosomal aberration involving PAX7 is found in rhabdomyosarcoma. Translocation t(1;13)(p36;q14) with FOXO1. The resulting protein is a transcriptional activator.
  • Sequence similarities

    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 paired domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ37460 antibody
    • HUP1 antibody
    • OTTHUMP00000002534 antibody
    • Paired box 7 antibody
    • Paired box gene 7 antibody
    • Paired box homeotic gene 7 antibody
    • Paired box protein Pax-7 antibody
    • Paired domain gene 7 antibody
    • Paired domain gene HuP1 antibody
    • Pax7 antibody
    • PAX7 transcriptional factor antibody
    • PAX7/FKHR fusion gene, included antibody
    • PAX7_HUMAN antibody
    • PAX7B antibody
    • RGD1564360 antibody
    • RMS2 antibody
    see all

Images

  • Anti-PAX7 antibody [PAX7497] (ab199010) at 1 µg/ml + HeLa cell lysate

    Predicted band size: 57 kDa

  • Ab199010 staining PAX7 in Mouse tibialis tissue by ICC/IF (Immunocytochemistry/Immunofluorescence). Cells were fixed with paraformaldehyde and blocked with 100% CAS block for 1 hour at 26°C; permeabilized with tween. Samples were incubated the primary antibody (1/150 in PBS + Tween) for 16 hours at 4°C. An Alexa Fluor® 488 Goat polyclonal (1/1000 dilution) was used as the secondary antibody. 

    See Abreview

References

This product has been referenced in:

  • Syverud BC  et al. Label-Free, High-Throughput Purification of Satellite Cells Using Microfluidic Inertial Separation. Tissue Eng Part C Methods 24:32-41 (2018). Read more (PubMed: 28946802) »
  • Wang QQ  et al. Human Umbilical Cord Wharton's Jelly Derived Mesenchymal Stromal Cells May Attenuate Sarcopenia in Aged Mice Induced by Hindlimb Suspension. Med Sci Monit 24:9272-9281 (2018). Read more (PubMed: 30571669) »
See all 2 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Muscle)
Permeabilization
Yes - Tween
Specification
Muscle
Blocking step
CAS Block as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 26°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 01 2016

Application
Western blot
Sample
Mouse Cell lysate - nuclear (Muscle)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
40 µg
Specification
Muscle
Blocking step
Seablock as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 27°C

Abcam user community

Verified customer

Submitted Nov 07 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up