Overview

  • Product name

    Anti-PAXX antibody
  • Description

    Rabbit polyclonal to PAXX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PAXX aa 109-204.
    Sequence:

    LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGP QLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET

  • Positive control

    • IHC_P: Human pancreas, prostate and stomach tissue RT4, U251 MG, Human liver tissue and Human tonsil tissue lysates.
  • General notes

    Protein target previously labeled as C9orf142. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab126353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 22 kDa.
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

Images

  • All lanes : Anti-PAXX antibody (ab126353) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 22 kDa

  • ab126353 at a 1/1000 dilution staining PAXX in paraffin embedded Human pancreas tissue by immunohistochemistry.

  • Immunofluorescent staining of Human cell line U-251 MG shows positivity in nucleus but not nucleoli. Recommended concentration of ab126353 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • Immunohistochemical analysis of human stomach tissue labeling PAXX with ab126353 at 1/2500 dilution.
  • Immunohistochemical analysis of human prostate tissue labeling PAXX with ab126353 at 1/2500 dilution.
  • Immunohistochemical analysis of human skeletal muscle tissue labeling PAXX with ab126353 at 1/2500 dilution. No positivity seen in myocytes as expected.

References

This product has been referenced in:

  • Gago-Fuentes R  et al. Normal development of mice lacking PAXX, the paralogue of XRCC4 and XLF. FEBS Open Bio 8:426-434 (2018). Read more (PubMed: 29511619) »
  • Bhargava R  et al. C-NHEJ without indels is robust and requires synergistic function of distinct XLF domains. Nat Commun 9:2484 (2018). Read more (PubMed: 29950655) »
See all 9 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa)
Gel Running Conditions
Reduced Denaturing
Loading amount
20 µg
Specification
HeLa
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 17 2017

Application
Western blot
Sample
Mouse Cell lysate - whole cell (MEF and vAbl pro-B)
Gel Running Conditions
Non-reduced Denaturing (gel 12%)
Loading amount
70 µg
Specification
MEF and vAbl pro-B
Blocking step
Milk as blocking agent for 15 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Sep 25 2015

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa, RPE-1)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
50 µg
Specification
HeLa, RPE-1
Blocking step
Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Jul 08 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up