Overview

  • Product name

  • Description

    Rabbit polyclonal to PBK/SPK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human PBK/SPK aa 4-136.
    Sequence:

    ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSP RGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAF TEANDGSLCLAMEYGGEKSLNDLIEERYKASQD


    Database link: Q96KB5

  • Positive control

    • Human testis tissue; RT-4 and U-251 MG cell line lysates.
  • General notes

     This product was previously labelled as PBK

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 36 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
  • Tissue specificity

    Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated; in a cell-cycle dependent manner at mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 84 antibody
    • CT84 antibody
    • Epididymis luminal protein 164 antibody
    • FLJ14385 antibody
    • HEL164 antibody
    • Lymphokine activated killer T cell originated protein kinase antibody
    • Lymphokine-activated killer T-cell-originated protein kinase antibody
    • MAPKK like protein kinase antibody
    • MAPKK-like protein kinase antibody
    • Nori 3 antibody
    • Nori-3 antibody
    • Nori3 antibody
    • PBK antibody
    • PDZ binding kinase antibody
    • PDZ-binding kinase antibody
    • Serine/threonine protein kinase antibody
    • Spermatogenesis related protein kinase antibody
    • Spermatogenesis-related protein kinase antibody
    • SPK antibody
    • T LAK cell originated protein kinase antibody
    • T-LAK cell-originated protein kinase antibody
    • TOPK antibody
    • TOPK_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human testis tissue labeling PBK/SPK with ab220106 at 1/1000 dilution.

  • All lanes : Anti-PBK/SPK antibody (ab220106) at 1/250 dilution

    Lane 1 : RT-4 cell line lysate
    Lane 2 : U-251 MG cell line lysate

    Predicted band size: 36 kDa

References

This product has been referenced in:

  • Wang Z  et al. MicroRNA-372 enhances radiosensitivity while inhibiting cell invasion and metastasis in nasopharyngeal carcinoma through activating the PBK-dependent p53 signaling pathway. Cancer Med 8:712-728 (2019). Read more (PubMed: 30656832) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up