Anti-PBR antibody (ab171776)
Key features and details
- Mouse polyclonal to PBR
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PBR antibody
See all PBR primary antibodies -
Description
Mouse polyclonal to PBR -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human PBR aa 1-169.
Sequence:MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLG PVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFF GARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTL NYCVWRDNHGWHGGRRLPE
Database link: AAH01110.1 -
Positive control
- PBR-transfected 293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab171776 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. |
Target
-
Function
Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells. -
Tissue specificity
Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids. -
Sequence similarities
Belongs to the TspO/BZRP family. -
Cellular localization
Mitochondrion membrane. - Information by UniProt
-
Database links
- Entrez Gene: 706 Human
- Omim: 109610 Human
- SwissProt: B1AH88 Human
- SwissProt: P30536 Human
- Unigene: 202 Human
-
Alternative names
- Benzodiazapine receptor (peripheral) antibody
- Benzodiazepine peripheral binding site antibody
- BPBS antibody
see all
Images
-
All lanes : Anti-PBR antibody (ab171776) at 1 µg/ml
Lane 1 : PBR-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution
Predicted band size: 19 kDa
Datasheets and documents
References (0)
ab171776 has not yet been referenced specifically in any publications.