Overview

  • Product name

  • Description

    Rabbit polyclonal to PC1/3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PC1/3 aa 500-738. (Expressed in E.coli).
    Sequence:

    AIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFK NWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPE HMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKSPSSS SVGGRRDELEEGAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYEN FYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRD


    Database link: P29120

  • Positive control

    • IHC-P: Human kidney, breast cancer, prostate cancer, liver, prostate and liver cancer tissues. WB: Pig heart, brain, kidney and liver lysates; Recombinant human PC1/3 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 84 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.
  • Involvement in disease

    Defects in PCSK1 are the cause of proprotein convertase 1 deficiency (PC1 deficiency) [MIM:600955]. PC1 deficiency is characterized by obesity, hypogonadism, hypoadrenalism, reactive hypoglycemia as well as marked small-intestinal absorptive dysfunction It is due to impaired processing of prohormones.
  • Sequence similarities

    Belongs to the peptidase S8 family. Furin subfamily.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle. Localized in the secretion granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • BDP antibody
    • NEC 1 antibody
    • NEC1 antibody
    • NEC1_HUMAN antibody
    • Neuroendocrine convertase 1 antibody
    • PC1 antibody
    • PC3 antibody
    • PCSK1 antibody
    • Prohormone convertase 1 antibody
    • Prohormone convertase 1/3 antibody
    • Prohormone convertase 3 antibody
    • Proprotein convertase 1 antibody
    • SPC3 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for PC1/3 using ab232716 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for PC1/3 using ab232716 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for PC1/3 using ab232716 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for PC1/3 using ab232716 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for PC1/3 using ab232716 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for PC1/3 using ab232716 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PC1/3 antibody (ab232716) at 1 µg/ml + Recombinant human PC1/3 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

  • All lanes : Anti-PC1/3 antibody (ab232716) at 1 µg/ml

    Lane 1 : Pig heart lysate
    Lane 2 : Pig brain lysate
    Lane 3 : Pig kidney lysate
    Lane 4 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

References

ab232716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up