Overview

  • Product name

  • Description

    Rabbit polyclonal to PC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PC4 aa 8-117.
    Sequence:

    VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSS SRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNP EQWSQLKEQI


    Database link: P53999

  • Positive control

    • ICC/IF: U-2 OS cells. WB: RPMI-8226 cell lysate. IHC-P: Human cerebellum, tonsil, skeletal muscle and rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 14 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).
  • Sequence similarities

    Belongs to the transcriptional coactivator PC4 family.
  • Post-translational
    modifications

    Activity is controlled by protein kinases that target the regulatory region. Phosphorylation inactivates both ds DNA-binding and cofactor function, but does not affect binding to ssDNA. Seems to be phosphorylated in vivo by CK2 in at least 7 sites in the N-terminal Ser-rich region.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activated RNA polymerase II transcriptional coactivator p15 antibody
    • Interferon related developmental regulator 1 antibody
    • MGC102747 antibody
    • p14 antibody
    • P15 antibody
    • PC4 antibody
    • PC4 LSB antibody
    • Positive cofactor 4 antibody
    • RPO2TC1 antibody
    • Sub1 antibody
    • SUB1 homolog antibody
    • TCP4_HUMAN antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling PC4 using ab244248 at 4 µg/ml (green) in ICC/IF.

  • Anti-PC4 antibody (ab244248) at 0.4 µg/ml + RPMI-8226 (Human cell line) cell lysate

    Predicted band size: 14 kDa

  • Formalin-fixed, paraffin-embedded human tonsil tissue stained for PC4 with ab244248 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebellum tissue stained for PC4 with ab244248 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for PC4 with ab244248 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for PC4 with ab244248 at a 1/200 dilution in immunohistochemical analysis.

References

ab244248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up