Overview

  • Product name

  • Description

    Rabbit polyclonal to PC6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PC6 aa 504-626.
    Sequence:

    YLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWE FMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPY SPTNEFPKVERFRYSRVEDPTDD


    Database link: Q92824

  • Positive control

    • IHC-P: Human duodenum tissue. ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif.
  • Tissue specificity

    Expressed in T-lymphocytes.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
    Contains 1 PLAC domain.
  • Domain

    The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ11149 antibody
    • FLJ16215 antibody
    • hPC6 antibody
    • PC5 antibody
    • PC6 antibody
    • PC6A antibody
    • Pcsk5 antibody
    • PCSK5_HUMAN antibody
    • Prohormone convertase 5 antibody
    • Proprotein convertase 5 antibody
    • Proprotein convertase 6 antibody
    • Proprotein convertase PC5 antibody
    • Proprotein convertase subtilisin/kexin type 5 antibody
    • Protease PC6 antibody
    • SPC6 antibody
    • Subtilisin/kexin-like protease PC5 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for PC6 using ab224483 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for PC6 (green) using ab224483 at 4 µg/ml in ICC/IF.

References

ab224483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up