Overview

  • Product name

  • Description

    Rabbit polyclonal to PC7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PC7 aa 189-362.
    Sequence:

    GVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAA VPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSW GPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCN YDGYANSIYTVTIGAVDEEGRMPF


    Database link: Q16549

  • Positive control

    • IHC-P: Human colon cancer tissue.
  • General notes

     This product was previously labelled as PCSK7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.

Target

  • Function

    Likely to represent a ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RXXX[KR]R consensus motif.
  • Tissue specificity

    Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
  • Post-translational
    modifications

    Cysteine residues in the cytoplasmic tail are probably palmitoylated.
    N-glycosylated.
  • Cellular localization

    Golgi apparatus > trans-Golgi network membrane. Seems to be localized intracellularly to the trans Golgi network.
  • Information by UniProt
  • Database links

  • Alternative names

    • hPC8 antibody
    • LPC antibody
    • Lymphoma proprotein convertase antibody
    • PC7 antibody
    • PC8 antibody
    • Pcsk7 antibody
    • PCSK7_HUMAN antibody
    • Prohormone convertase 7 antibody
    • Prohormone convertase 8 antibody
    • Proprotein convertase 7 antibody
    • Proprotein convertase 8 antibody
    • Proprotein convertase PC7 antibody
    • Proprotein convertase subtilisin/kexin type 7 antibody
    • SPC7 antibody
    • Subtilisin/kexin-like protease PC7 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for PC7 with ab238587 at a 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up