Overview

  • Product name

  • Description

    Rabbit polyclonal to PCB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PCB aa 74-371. (BC011617).
    Sequence:

    QMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSE RADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAP ITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSE ALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQK VVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFI EVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRING


    Database link: P11498

  • Positive control

    • Raji, HEK293 and 293T cell lysates, Human fetal brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab196277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 130 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
  • Pathway

    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease

    Defects in PC are the cause of pyruvate carboxylase deficiency (PC deficiency) [MIM:266150]. PC deficiency leads to lactic acidosis, mental retardation and death. It occurs in three forms: mild or type A, severe neonatal or type B, and a very mild lacticacidemia.
  • Sequence similarities

    Contains 1 ATP-grasp domain.
    Contains 1 biotin carboxylation domain.
    Contains 1 biotinyl-binding domain.
    Contains 1 carboxyltransferase domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • mitochondrial antibody
    • OTTHUMP00000235155 antibody
    • OTTHUMP00000235156 antibody
    • PC antibody
    • PCB antibody
    • Pcx antibody
    • PYC_HUMAN antibody
    • Pyruvate carboxylase antibody
    • Pyruvate carboxylase mitochondrial antibody
    • Pyruvic carboxylase antibody
    see all

Images

  • All lanes : Anti-PCB antibody (ab196277) at 1/500 dilution

    Lane 1 : Raji cell lysate
    Lane 2 : HEK293 cell lysate
    Lane 3 : 293T cell lysate

    Predicted band size: 130 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal brain tissue labeling PCB with ab196277 at 1/100 dilution.

References

ab196277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up