Anti-PCB antibody (ab221080)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-PCB antibody
See all PCB primary antibodies -
DescriptionRabbit polyclonal to PCB
-
Host speciesRabbit
-
Tested applicationsSuitable for: WB, ICC/IFmore details
-
Species reactivityReacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human PCB aa 1017-1113. Numbering is from isoform 1.
Sequence:FAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVS DLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIG
Database link: P11498 -
Positive control
- WB; Liver tissue extract. ICC/IF; MCF7 cells.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferpH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
PurityImmunogen affinity purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221080 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/250. Predicted molecular weight: 130 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
FunctionPyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
-
PathwayCarbohydrate biosynthesis; gluconeogenesis.
-
Involvement in diseaseDefects in PC are the cause of pyruvate carboxylase deficiency (PC deficiency) [MIM:266150]. PC deficiency leads to lactic acidosis, mental retardation and death. It occurs in three forms: mild or type A, severe neonatal or type B, and a very mild lacticacidemia.
-
Sequence similaritiesContains 1 ATP-grasp domain.
Contains 1 biotin carboxylation domain.
Contains 1 biotinyl-binding domain.
Contains 1 carboxyltransferase domain. -
Cellular localizationMitochondrion matrix.
- Information by UniProt
-
Database links
- Entrez Gene: 338471 Cow
- Entrez Gene: 5091 Human
- Entrez Gene: 18563 Mouse
- Entrez Gene: 25104 Rat
- Omim: 608786 Human
- SwissProt: Q29RK2 Cow
- SwissProt: P11498 Human
- SwissProt: Q05920 Mouse
see all -
Alternative names
- mitochondrial antibody
- OTTHUMP00000235155 antibody
- OTTHUMP00000235156 antibody
see all
Images
-
Western blot - Anti-PCB antibody (ab221080)All lanes : Anti-PCB antibody (ab221080) at 1/100 dilution
Lane 1 : RT4 cell extract
Lane 2 : U-251 MG cell extract
Lane 3 : Human plasma
Lane 4 : Human liver tissue extract
Developed using the ECL technique.
Predicted band size: 130 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-PCB antibody (ab221080)Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling PCB with ab221080 at 4 µg/ml. Antibody staining is shown in green.
Datasheets and documents
References
ab221080 has not yet been referenced specifically in any publications.
