Overview

  • Product name
  • Description
    Rabbit polyclonal to PCB
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PCB aa 1017-1113. Numbering is from isoform 1.
    Sequence:

    FAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVS DLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIG


    Database link: P11498

  • Positive control
    • WB; Liver tissue extract. ICC/IF; MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 130 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
  • Pathway
    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease
    Defects in PC are the cause of pyruvate carboxylase deficiency (PC deficiency) [MIM:266150]. PC deficiency leads to lactic acidosis, mental retardation and death. It occurs in three forms: mild or type A, severe neonatal or type B, and a very mild lacticacidemia.
  • Sequence similarities
    Contains 1 ATP-grasp domain.
    Contains 1 biotin carboxylation domain.
    Contains 1 biotinyl-binding domain.
    Contains 1 carboxyltransferase domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • mitochondrial antibody
    • OTTHUMP00000235155 antibody
    • OTTHUMP00000235156 antibody
    • PC antibody
    • PCB antibody
    • Pcx antibody
    • PYC_HUMAN antibody
    • Pyruvate carboxylase antibody
    • Pyruvate carboxylase mitochondrial antibody
    • Pyruvic carboxylase antibody
    see all

Images

  • All lanes : Anti-PCB antibody (ab221080) at 1/100 dilution

    Lane 1 : RT4 cell extract
    Lane 2 : U-251 MG cell extract
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue extract

    Developed using the ECL technique.

    Predicted band size: 130 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling PCB with ab221080 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up