Anti-PCB antibody (ab221080)
Key features and details
- Rabbit polyclonal to PCB
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PCB antibody
See all PCB primary antibodies -
Description
Rabbit polyclonal to PCB -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human PCB aa 1017-1113. Numbering is from isoform 1.
Sequence:FAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVS DLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIG
Database link: P11498 -
Positive control
- WB; Liver tissue extract. ICC/IF; MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221080 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 130 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate. -
Pathway
Carbohydrate biosynthesis; gluconeogenesis. -
Involvement in disease
Defects in PC are the cause of pyruvate carboxylase deficiency (PC deficiency) [MIM:266150]. PC deficiency leads to lactic acidosis, mental retardation and death. It occurs in three forms: mild or type A, severe neonatal or type B, and a very mild lacticacidemia. -
Sequence similarities
Contains 1 ATP-grasp domain.
Contains 1 biotin carboxylation domain.
Contains 1 biotinyl-binding domain.
Contains 1 carboxyltransferase domain. -
Cellular localization
Mitochondrion matrix. - Information by UniProt
-
Database links
- Entrez Gene: 338471 Cow
- Entrez Gene: 5091 Human
- Entrez Gene: 18563 Mouse
- Entrez Gene: 25104 Rat
- Omim: 608786 Human
- SwissProt: Q29RK2 Cow
- SwissProt: P11498 Human
- SwissProt: Q05920 Mouse
see all -
Alternative names
- mitochondrial antibody
- OTTHUMP00000235155 antibody
- OTTHUMP00000235156 antibody
see all
Images
-
All lanes : Anti-PCB antibody (ab221080) at 1/100 dilution
Lane 1 : RT4 cell extract
Lane 2 : U-251 MG cell extract
Lane 3 : Human plasma
Lane 4 : Human liver tissue extract
Developed using the ECL technique.
Predicted band size: 130 kDa -
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling PCB with ab221080 at 4 µg/ml. Antibody staining is shown in green.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab221080 has not yet been referenced specifically in any publications.