Overview

  • Product name
  • Description
    Rabbit polyclonal to PCB
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PCB aa 36-486. (Expressed in E.coli).
    Sequence:

    PIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYL IGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAG VRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSN TYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFV EKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDP QLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTV TEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPAR SFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKD HPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENP E


    Database link: P11498

  • Positive control
    • WB: Recombinant human PCB protein; Pig cerebrum and liver lysates. IHC-P: Human cerebrum, kidney and liver tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab233106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 130 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
  • Pathway
    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease
    Defects in PC are the cause of pyruvate carboxylase deficiency (PC deficiency) [MIM:266150]. PC deficiency leads to lactic acidosis, mental retardation and death. It occurs in three forms: mild or type A, severe neonatal or type B, and a very mild lacticacidemia.
  • Sequence similarities
    Contains 1 ATP-grasp domain.
    Contains 1 biotin carboxylation domain.
    Contains 1 biotinyl-binding domain.
    Contains 1 carboxyltransferase domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • mitochondrial antibody
    • OTTHUMP00000235155 antibody
    • OTTHUMP00000235156 antibody
    • PC antibody
    • PCB antibody
    • Pcx antibody
    • PYC_HUMAN antibody
    • Pyruvate carboxylase antibody
    • Pyruvate carboxylase mitochondrial antibody
    • Pyruvic carboxylase antibody
    see all

Images

  • Anti-PCB antibody (ab233106) at 2 µg/ml + Recombinant human PCB protein

    Predicted band size: 130 kDa

  • Anti-PCB antibody (ab233106) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 130 kDa

  • Anti-PCB antibody (ab233106) at 2 µg/ml + Pig liver lysate

    Predicted band size: 130 kDa

  • Paraffin-embedded human cerebrum tissue stained for PCB using ab233106 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for PCB using ab233106 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for PCB using ab233106 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up