Overview

  • Product name

  • Description

    Rabbit polyclonal to PCDH10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PCDH10 aa 515-715.
    Sequence:

    YVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATVNILI VDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENA RLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHG QPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQRPSRSGGGETSLDL T


    Database link: Q9P2E7

  • Positive control

    • IHC-P: Human brain and glioma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Potential calcium-dependent cell-adhesion protein.
  • Tissue specificity

    Moderately expressed in all regions of the brain examined, as well as in testis and ovary, and low expression in all other tissues tested.
  • Sequence similarities

    Contains 6 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp761O2023 antibody
    • KIAA1400 antibody
    • MGC133344 antibody
    • OL PCDH antibody
    • Ortholog of OL pcdh antibody
    • OTTHUMP00000220001 antibody
    • PCD10_HUMAN antibody
    • PCDH10 antibody
    • PCDH19 antibody
    • Protocadherin 10 antibody
    • Protocadherin-10 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for PCDH10 using ab230408 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for PCDH10 using ab230408 at 1/100 dilution in immunohistochemical analysis.

References

ab230408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up