Overview

  • Product name

  • Description

    Sheep polyclonal to PCDH12
  • Host species

    Sheep
  • Specificity

    In direct ELISAs, less than 1% cross-reactivity with recombinant human PCDH18 is observed.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse PCDH12 aa 18-716. (Derived from Mouse myeloma cell line NS0).
    Sequence:

    LFISGDCQEVATVMVKFQVTEEVPSGTVIGKLSQELRVEERRGKAGDAFQ ILQLPQALPVQMNSEDGLLSTSSRLDREKLCRQEDPCLVSFDVLATGASA LIHVEIQVLDINDHQPQFPKDEQELEISESASLHTRIPLDRALDQDTGPN SLYSYSLSPSEHFALDVIVGPDETKHAELVVVKELDRELHSYFDLVLTAY DNGNPPKSGISVVKVNVLDSNDNSPVFAESSLALEIPEDTVPGTLLINLT ATDPDQGPNGEVEFFFGKHVSPEVMNTFGIDAKTGQIILRQALDYEKNPA YEVDVQARDLGPNSIPGHCKVLIKVLDVNDNAPSILITWASQTSLVSEDL PRDSFIALVSANDLDSGNNGLVHCWLNQELGHFRLKRTNGNTYMLLTNAT LDREQWPIYTLTVFAQDQGPQPLSAEKELQIQVSDVNDNAPVFEKSRYEV STWENNPPSLHLITLKAHDADLGSNGKVSYRIKDSPVSHLVIIDFETGEV TAQRSLDYEQMAGFEFQVIAEDRGQPQLASSISVWVSLLDANDNAPEVIQ PVLSEGKATLSVLVNASTGHLLLPIENPSGMDPAGTGIPPKATHSPWSFL LLTIVARDADSGANGELFYSIQSGNDAHLFFLSPSLGQLFINVTNASSLI GSQWDLGIVVEDQGSPSLQTQVSLKVVFVTSVDHLRDSAHEPGVLSTPA


    Database link: O55134

  • Positive control

    • Mouse bone marrow tissue lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab215065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 160 kDa (predicted molecular weight: 129 kDa).

Target

  • Function

    Cellular adhesion molecule that may play an important role in cell-cell interactions at interendothelial junctions. Promotes homotypic calcium dependent aggregation and adhesion and clusters at intercellular junctions. Unable to bind to catenins, weakly associates with the cytoskeleton.
  • Tissue specificity

    Expressed in highly vascularized tissues including the heart and placenta, but most tissues contain a low level of expression. Prominent expression in the spleen.
  • Sequence similarities

    Contains 6 cadherin domains.
  • Cellular localization

    Cell membrane. Cell junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • PCD12_HUMAN antibody
    • Pcdh12 antibody
    • Protocadherin 12 antibody
    • Protocadherin-12 antibody
    • Vascular cadherin 2 antibody
    • Vascular cadherin-2 antibody
    • Vascular endothelial cadherin 2 antibody
    • Vascular endothelial cadherin-2 antibody
    • VE cadherin 2 antibody
    • VE-cad-2 antibody
    • VE-cadherin-2 antibody
    • VECAD2 antibody
    see all

Images

References

ab215065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up