Anti-PCDH18 antibody (ab224404)
Key features and details
- Rabbit polyclonal to PCDH18
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PCDH18 antibody -
Description
Rabbit polyclonal to PCDH18 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human PCDH18 aa 754-859.
Sequence:IHKGDITLVPTINGTLPIRSHHRSSPSSSPTLERGQMGSRQSHNSHQSLN SLVTISSNHVPENFSLELTHATPAVEQVSQLLSMLHQGQYQPRPSFRGNK YSRSYR
Database link: Q9HCL0 -
Positive control
- IHC-P: Human placenta tissue. WB: Mouse liver lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224404 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 126 kDa. |
Target
-
Function
Potential calcium-dependent cell-adhesion protein. -
Tissue specificity
Expressed in all tissues, with highest expression in lung and ovary. -
Sequence similarities
Contains 6 cadherin domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 539464 Cow
- Entrez Gene: 54510 Human
- Entrez Gene: 73173 Mouse
- Omim: 608287 Human
- SwissProt: A7MB46 Cow
- SwissProt: Q9HCL0 Human
- SwissProt: Q8VHR0 Mouse
- Unigene: 591691 Human
-
Form
Ther are 2 isoforms produced by alternative splicing. -
Alternative names
- DKFZp434B0923 antibody
- KIAA1562 antibody
- PCD18_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PCDH18 antibody (ab224404)
Paraffin-embedded human placenta tissue stained for PCDH18 using ab224404 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-PCDH18 antibody (ab224404) at 1/100 dilution
Lane 1 : Mouse liver lysate
Lane 2 : Rat liver lysate
Predicted band size: 126 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224404 has not yet been referenced specifically in any publications.