Overview

  • Product name

  • Description

    Rabbit polyclonal to PCDH19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PCDH19 aa 568-678.
    Sequence:

    LINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRGFFEI DQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALVLIYLSPALD AQESMGSVNLS


    Database link: Q8TAB3

  • Positive control

    • IHC-P: Human brain and glioma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Potential calcium-dependent cell-adhesion protein.
  • Tissue specificity

    Moderately expressed in all regions of the brain examined, with lowest levels found in the cerebellum. Moderate expression is also found in ovary, and low expression in all other tissues tested. Also detected in primary skin fibroblast.
  • Involvement in disease

    Epileptic encephalopathy, early infantile, 9
  • Sequence similarities

    Contains 6 cadherin domains.
  • Developmental stage

    Expressed in developing cortical plate, amygdala and subcortical regions and in the ganglionic eminence.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1313 antibody
    • PCD19_HUMAN antibody
    • PCDH19 antibody
    • Protocadherin 19 antibody
    • Protocadherin-19 antibody
    see all

Images

  • Paraffin-embedded human glioma tissue stained for PCDH19 using ab230180 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for PCDH19 using ab230180 at 1/100 dilution in immunohistochemical analysis.

References

ab230180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up