Overview

  • Product name

    Anti-PCDH20 antibody
  • Description

    Rabbit polyclonal to PCDH20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PCDH20 aa 168-445. (BC027907).
    Sequence:

    VKIAIRDINDNAPQFPVSQISVWVPENAPVNTRLAIEHPAVDPDVGINGV QTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDRETQDQYVSIIIAED GGSPPLLGSATLTIGISDINDNCPLFTDSQINVTVYGNATVGTPIAAVQA VDKDLGTNAQITYSYSQKVPQASKDLFHLDENTGVIKLFSKIGGSVLESH KLTILANGPGCIPAVITALVSIIKVIFRPPEIVPRYIANEIDGVVYLKEL EPVNTPIAFFTIRDPEGKYKVNCYLDGE

  • Positive control

    • Human fetal brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab197196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 102 kDa.

Target

Images

  • Anti-PCDH20 antibody (ab197196) at 1/1000 dilution + Human fetal brain lysate

    Predicted band size: 102 kDa

References

ab197196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up