Overview

  • Product name

  • Description

    Rabbit polyclonal to PCDH7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human PCDH7 aa 455-505 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    NGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLDYEATREFNVV I


    Database link: O60245

  • Positive control

    • Human glioma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Tissue specificity

    Expressed predominantly in brain and heart and at lower levels in various other tissues.
  • Sequence similarities

    Contains 7 cadherin domains.
  • Post-translational
    modifications

    Isoform C is phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BH Pcdh antibody
    • BH protocadherin antibody
    • BH-Pcdh antibody
    • BHPCDH antibody
    • Brain heart protocadherin antibody
    • Brain-heart protocadherin antibody
    • PCDH 7 antibody
    • PCDH7 antibody
    • PCDH7_HUMAN antibody
    • Protocadherin 7 antibody
    • Protocadherin-7 antibody
    see all

Images

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded Human glioma tissue labeling PCDH7 with ab214189 at 1/300 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up