Overview

  • Product name

    Anti-PCDH7 antibody - C-terminal
    See all PCDH7 primary antibodies
  • Description

    Rabbit polyclonal to PCDH7 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human PCDH7 aa 1019-1069 (C terminal). The exact sequence is proprietary. NP_002580.2.
    Sequence:

    QAVQDLPPANTFVGAGDNISIGSDHCSEYSCQTNNKYSKQMRLHPYITVF G


    Database link: O60245

  • Positive control

    • HeLa, 293T, Jurkat and mouse NIH 3T3 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab191191 was affinity purified using an epitope specific to PCDH7 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 116 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Tissue specificity

      Expressed predominantly in brain and heart and at lower levels in various other tissues.
    • Sequence similarities

      Contains 7 cadherin domains.
    • Post-translational
      modifications

      Isoform C is phosphorylated upon DNA damage, probably by ATM or ATR.
    • Cellular localization

      Cell membrane.
    • Information by UniProt
    • Database links

    • Alternative names

      • BH Pcdh antibody
      • BH protocadherin antibody
      • BH-Pcdh antibody
      • BHPCDH antibody
      • Brain heart protocadherin antibody
      • Brain-heart protocadherin antibody
      • PCDH 7 antibody
      • PCDH7 antibody
      • PCDH7_HUMAN antibody
      • Protocadherin 7 antibody
      • Protocadherin-7 antibody
      see all

    Images

    • All lanes : Anti-PCDH7 antibody - C-terminal (ab191191) at 1 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate
      Lane 4 : TCMK1 whole cell lysate
      Lane 5 : NIH 3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 116 kDa


      Exposure time: 3 minutes

    References

    ab191191 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab191191.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up