Overview

  • Product name

    Anti-PCDH9 antibody [7G3A2]
  • Description

    Mouse monoclonal [7G3A2] to PCDH9
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PCDH9 aa 24-148. Expressed in E.coli.
    Sequence:

    QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDA PLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFF RLIKIKIIVKDTNDNAPMFPSPVIN


    Database link: Q9HC56

  • Positive control

    • WB: Recombinant human PCDH9 (aa24-148) protein; PCDH9 (aa24-148)-IgG-Fc-transfected HEK-293 cell lysate; C6 cell lysate. ICC/IF: HeLa cells. Flow cyt: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7G3A2
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 136 kDa.
Flow Cyt 1/200 - 1/400.
ICC/IF 1/50 - 1/250.

Target

Images

  • Anti-PCDH9 antibody [7G3A2] (ab233710) at 1/500 dilution + Recombinant human PCDH9 (aa24-148) protein

    Developed using the ECL technique.

    Predicted band size: 136 kDa

  • All lanes : Anti-PCDH9 antibody [7G3A2] (ab233710) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human PCDH9 (aa24-148)-IgG-Fc-transfected HEK-293 cell lysate

    Developed using the ECL technique.

    Predicted band size: 136 kDa

  • Anti-PCDH9 antibody [7G3A2] (ab233710) at 1/500 dilution + C6 (rat glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 136 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PCDH9 (green) using ab233710 at 1/50 dilution in ICC/IF. Actin is labeled with AlexaFluor®555-Phalloidin (red). Blue: DRAQ5 DNA dye. 

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling PCDH9 with ab233710 at 1/200 dilution (green) compared with a negative control (red).

References

ab233710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up