Overview

  • Product name

  • Description

    Rabbit polyclonal to PCDHA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PCDHA1 aa 30-242. Expressed in E. coli.
    Sequence:

    QLHYSIPEEAKHGTFVGRVAQDLGLELAELVPRLFRVASKTHRDLLEVNL QNGILFVNSRIDREELCQWSAECSIHLELIADRPLQVFHVEVKVKDINDN PPVFRGREQIIFIPESRLLNSRFPIEGAADADIGANALLTYTLSPSDYFS LDVEASDELSKSLWLELRKYLDREETPELHLLLTATDGGKPELQGTVELL ITVLDVNDNAPLF


    Database link: Q9Y5I3-1

  • Positive control

    • IHC-P: Human cerebrum tissue. WB: Recombinant human PCDHA1 protein; Human serum.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 103 kDa.

Target

  • Relevance

    PCDHA1 (Protocadherin alpha 1) is a member of the protocadherin family, a subgroup of the cadherin superfamily. Protocadherins are neural cadherin-like cell adhesion proteins that are integral membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific neuronal connections in the brain. PCDHA1 is one of fifteen tandemly arranged genes within the alpha cluster of protocadherin genes on 5q31.
  • Cellular localization

    Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted.
  • Database links

  • Alternative names

    • KIAA0345 like 13 antibody
    • PCDH alpha1 antibody
    • PCDHA 1 antibody
    • Protocadherin alpha 1 antibody

Images

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for PCDHA1 with ab231152 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PCDHA1 antibody (ab231152) at 1 µg/ml + Human serum

    Predicted band size: 103 kDa

  • Anti-PCDHA1 antibody (ab231152) at 2 µg/ml + Recombinant human PCDHA1 protein

    Predicted band size: 103 kDa

References

ab231152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up