Overview

  • Product name

    Anti-PCDHA12 antibody
  • Description

    Rabbit polyclonal to PCDHA12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human PCDHA12 aa 862-941.
    Sequence:

    YGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKE ETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ


    Database link: Q9UN75

  • Positive control

    • IHC-P: Human gastric cancer and glioma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
  • Sequence similarities

    Contains 6 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0345 like 2 antibody
    • MGC138485 antibody
    • MGC141932 antibody
    • PCDAC_HUMAN antibody
    • PCDH alpha 12 antibody
    • PCDH alpha12 antibody
    • PCDH-alpha-12 antibody
    • PCDHA12 antibody
    • Protocadherin alpha 12 antibody
    • Protocadherin alpha-12 antibody
    see all

Images

  • Paraffin-embedded human gastric cancer tissue stained for PCDHA12 using ab234787 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for PCDHA12 using ab234787 at 1/100 dilution in immunohistochemical analysis.

References

ab234787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up