Anti-PCDHB15 antibody (ab233195)
Key features and details
- Rabbit polyclonal to PCDHB15
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PCDHB15 antibody
See all PCDHB15 primary antibodies -
Description
Rabbit polyclonal to PCDHB15 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Chimpanzee -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human PCDHB15 aa 35-347. Two N-terminal tags. (Expressed in E.coli).
Sequence:VMEETERGSFVANLANDLGLGVGELAERGARVVSEDNEQGLQLDLQTGQL ILNEKLDREKLCGPTEPCIMHFQVLLKKPLEVFRAELLVTDINDHSPEFP EREMTLKIPETSSLGTVFPLKKARDLDVGSNNVQNYNISPNSHFHVSTRT RGDGRKYPELVLDTELDREEQAELRLTLTAVDGGSPPRSGTVQILILVLD ANDNAPEFVQALYEVQVPENSPVGSLVVKVSARDLDTGTNGEISYSLYYS SQEIDKPFELSSLSGEIRLIKKLDFETMSSYDLDIEASDGGGLSGKCSVS VKVLDVNDNFPEL
Database link: Q9Y5E8 -
Positive control
- IHC-P: Human kidney tissue. WB: Recombinant human PCDHB15 protein; Mouse skeletal tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab233195 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 86 kDa. |
Target
-
Relevance
Protocadherin beta 15 (PCDHB15) is a member of the protocadherin family. Protocadherins constitute the largest subgroup within the cadherin family of calcium-dependent cell-cell adhesion molecules. They are neural cell surface proteins which are present at synaptic junctions. Their specific functions are unknown but they may be involved in the establishment and function of specific neuronal connections in the brain. PCDHB15 is one of sixteen tandemly arranged genes in the PCDHB gene cluster on chromosome 5q31. -
Cellular localization
Cell membrane; Single-pass type I membrane protein. -
Database links
- Entrez Gene: 56121 Human
- Entrez Gene: 93886 Mouse
- Omim: 606341 Human
- SwissProt: Q5DRD3 Chimpanzee
- SwissProt: Q9Y5E8 Human
- Unigene: 130757 Human
- Unigene: 283857 Mouse
-
Alternative names
- PCDH beta15 antibody
- PCDHB 15 antibody
- Protocadherin beta 15 antibody
Images
-
Anti-PCDHB15 antibody (ab233195) at 2 µg/ml + Mouse skeletal tissue lysate.
Predicted band size: 86 kDa -
Anti-PCDHB15 antibody (ab233195) at 2 µg/ml + Recombinant human PCDHB15 protein
Predicted band size: 86 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PCDHB15 antibody (ab233195)
Formalin-fixed, paraffin-embedded human kidney tissue stained for PCDHB15 using ab233195 at 20 µg/mL in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233195 has not yet been referenced specifically in any publications.