Overview

  • Product name

    Anti-PCDHGC5 antibody [OTI2E1]
  • Description

    Mouse monoclonal [OTI2E1] to PCDHGC5
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human PCDHGC5 aa 35-258. Produced in E.coli (NP_115783).
    Sequence:

    VVEESEPGTLVGNVAQDLGLKMTDLLSRRLQLGSEENGRYFSLSLMSGAL AVNQKIDRESLCGASTSCLLPVQVVTEHPLELIRVEVEILDLNDNSPSFA TPEREMRISESAASGARFPLDSAQDPDVGTNTVSFYTLSPNSHFSLNVKT LKDGKPFPELVLEQQLDREAQARHQLVLTAVDGGTPARSGTTLISVIVLD INDNAPTFQSSVLRVGIPENAPIG


    Database link: Q9Y5F6

  • Positive control

    • WB: pCMV6-ENTRY PCDHGC5 transfected HEK-293T cell lysate. IHC-P: Human lung carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI2E1
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Perform heat-induced epitope retrieval by Tris-EDTA, pH 8.0.

WB 1/2000. Predicted molecular weight: 102 kDa.

Target

  • Function

    Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
  • Sequence similarities

    Contains 6 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC138286 antibody
    • MGC138288 antibody
    • PCDGM_HUMAN antibody
    • PCDH-gamma-C5 antibody
    • PCDHGC5 antibody
    • Protocadherin gamma C5 antibody
    • protocadherin gamma subfamily C, 5 antibody
    • protocadherin gamma subfamily C, member 5 antibody
    • Protocadherin gamma-C5 antibody
    see all

Images

  • All lanes : Anti-PCDHGC5 antibody [OTI2E1] (ab236404) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY PCDHGC5 transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 102 kDa

  • Paraffin-embedded human lung carcinoma tissue stained for PCDHGC5 using ab236404 at 1/150 dilution in immunohistochemical analysis.

References

ab236404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up