Overview

  • Product name

  • Description

    Rabbit polyclonal to PCF11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PCF11 aa 1340-1435.
    Sequence:

    GIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLT DWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAG


    Database link: O94913

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of pre-mRNA cleavage complex II.
  • Sequence similarities

    Contains 1 CID domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • hPCF11 antibody
    • KIAA0824 antibody
    • OTTHUMP00000234826 antibody
    • PCF11 antibody
    • PCF11 cleavage and polyadenylation factor subunit antibody
    • PCF11, cleavage and polyadenylation factor II subunit, homolog antibody
    • PCF11, cleavage and polyadenylation factor subunit, homolog (S. antibody
    • PCF11_HUMAN antibody
    • PCF11p homolog antibody
    • Pre-mRNA cleavage complex 2 protein Pcf11 antibody
    • Pre-mRNA cleavage complex II protein Pcf11 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling PCF11 with ab220278 at 4 μg/ml (green).

References

ab220278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up