Overview

  • Product name

  • Description

    Rabbit polyclonal to PCGF6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Human PCGF6 aa 1-275.
    Sequence:

    MEGVAVVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSE TGAPGCSGSR PPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEE EDMSHFSLRLEGGRQDSEDEEE RLINLSELTPYILCSICKGYLIDATT ITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ PLYNISANEGTGHF KPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQ YQ TLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT


    Database link: Q9BYE7

  • General notes

     This product was previously labelled as RING6a

     

Properties

Applications

Our Abpromise guarantee covers the use of ab192395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 39 kDa.

Target

References

ab192395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
ChIP
Sample
Mouse Cell lysate - nuclear (ES-cells)
Negative control
IgG control antibody
Specification
ES-cells
Detection step
Real-time PCR
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 8 minute(s) and 0 second(s)
Specification of the cross-linking agent: PFA
Positive control
Anti-Histone H3 antibody Chip Grade ab1791

Abcam user community

Verified customer

Submitted Aug 21 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up