Overview

  • Product name

  • Description

    Rabbit polyclonal to PCID1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chicken, Cow, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human PCID1 aa 1-374.
    Sequence:

    MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD VCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPS LRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKW ISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQA RVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLA SYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQL YDTLNAWKQNLNKVKNSLLSLSDT


    Database link: Q7L2H7

  • Positive control

    • WB: HeLa and A549 whole cell lysates; Human placenta tissue lysate; Mouse gonadal, stomach and brain tissue lysates. IP: HeLa whole cell lysate. IHC-P: Human pancreatic cancer and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 43 kDa (predicted molecular weight: 28,43 kDa).
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).
  • Tissue specificity

    Broadly expressed.
  • Sequence similarities

    Belongs to the eIF-3 subunit M family.
    Contains 1 PCI domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • B5 antibody
    • B5 receptor antibody
    • Dendritic cell protein antibody
    • eIF3m antibody
    • EIF3M_HUMAN antibody
    • Eukaryotic translation initiation factor 3 subunit M antibody
    • Fetal lung protein B5 antibody
    • FLJ29030 antibody
    • GA17 antibody
    • hfl B5 antibody
    • hFL-B5 antibody
    • PCI domain containing 1 (herpesvirus entry mediator) antibody
    • PCI domain-containing protein 1 antibody
    • PCID1 antibody
    • TANGO7 antibody
    see all

Images

  • All lanes : Anti-PCID1 antibody (ab230105) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : Mouse gonadal tissue lysate
    Lane 4 : Human placenta tissue lysate
    Lane 5 : Mouse stomach tissue lysate
    Lane 6 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 28,43 kDa
    Observed band size: 43 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human pancreatic cancer tissue stained for PCID1 using ab230105 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for PCID1 using ab230105 at 1/100 dilution in immunohistochemical analysis.

  • PCID1 was immunoprecipitated from 0.5 mg HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate with 4 µg of ab230105. Western blot was performed from the immunoprecipitate using ab230105. HRP-conjugated light chain specific antibody was used as the secondary antibody at 1/50000 dilution.

    Lane 1: 1 µg control IgG instead of ab230105 in HeLa whole cell lysate .
    Lane 2: ab230105 IP in HeLa whole cell lysate.
    Lane 3: HeLa whole cell lysate 20 µg (Input).

References

ab230105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up