Overview

  • Product name

  • Description

    Rabbit polyclonal to PCID1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human PCID1 aa 2-374.
    Sequence:

    SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDV CLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSL RLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWI SDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQAR VDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLAS YVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQEL QIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLY DTLNAWKQNLNKVKNSLLSLSDT


    Database link: Q7L2H7

  • Positive control

    • WB: HeLa, HepG2 and A549 whole cell lysates; Rat heart and spleen lysates. IHC-P: Human testis and pancreatic cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 43 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).
  • Tissue specificity

    Broadly expressed.
  • Sequence similarities

    Belongs to the eIF-3 subunit M family.
    Contains 1 PCI domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • B5 antibody
    • B5 receptor antibody
    • Dendritic cell protein antibody
    • eIF3m antibody
    • EIF3M_HUMAN antibody
    • Eukaryotic translation initiation factor 3 subunit M antibody
    • Fetal lung protein B5 antibody
    • FLJ29030 antibody
    • GA17 antibody
    • hfl B5 antibody
    • hFL-B5 antibody
    • PCI domain containing 1 (herpesvirus entry mediator) antibody
    • PCI domain-containing protein 1 antibody
    • PCID1 antibody
    • TANGO7 antibody
    see all

Images

  • All lanes : Anti-PCID1 antibody (ab237504) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : Rat heart lysate
    Lane 5 : Rat spleen lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

  • Paraffin-embedded human testis tissue stained for PCID1 using ab237504 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for PCID1 using ab237504 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for PCID1 (green) using ab237504 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up