Overview

  • Product name

  • Description

    Rabbit polyclonal to PCMT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human PCMT1 aa 10-227. The exact sequence is proprietary.
    Sequence:

    HSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSP QSIGFQ ATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFAR MVGCTGKVIGIDHI KELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMG YAEEAPYDAIHVGAAAPVVPQA LIDQLKPGGRLILPVGPAGGNQMLEQ YDKLQDGSIKMKPLMGVIYVPLTDKEKQWS RWK


    Database link: P22061

  • Positive control

    • 293T cell lysate; Human tonsil tissue, A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.0
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 89% Tris glycine, 10% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/1000.
WB 1/500 - 1/3000. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 7.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Function: Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on EIF4EBP2, microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein. Similarity: Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • L isoaspartyl protein carboxyl methyltransferase antibody
    • L isoaspartyl/D aspartyl methyltransferase antibody
    • L-isoaspartyl protein carboxyl methyltransferase antibody
    • PCMT 1 antibody
    • Pcmt1 antibody
    • PIMT antibody
    • PIMT_HUMAN antibody
    • Protein beta aspartate methyltransferase antibody
    • Protein L isoaspartate (D aspartate) O methyltransferase antibody
    • Protein L isoaspartyl/D aspartyl methyltransferase antibody
    • Protein L-isoaspartyl/D-aspartyl methyltransferase antibody
    • Protein-beta-aspartate methyltransferase antibody
    • Protein-L-isoaspartate(D-aspartate) O-methyltransferase antibody
    see all

Images

  • Immunofluorescent analysis of methanol fixed A431 cells labeling PCMT1 with ab192790 at 1/200 (green). The cells were costained with Hoechst 33342.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human tonsil tissue labeling PCMT1 with an192790 at 7.5 µg/m.

  • Anti-PCMT1 antibody (ab192790) at 1/1000 dilution + 293T whole cell lysate at 30 µg

    Predicted band size: 25 kDa



    12% SDS PAGE

References

ab192790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up