Overview

  • Product name

  • Description

    Rabbit polyclonal to PCNA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Recombinant full length protein corresponding to Saccharomyces cerevisiae PCNA aa 1-258.
    Sequence:

    MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL EIGVEAFQEY RCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDS IILLFEDTKKDRIAEYSLKLMD IDADFLKIEELQYDSTLSLPSSEFSK IVRDLSQLSDSINIMITKETIKFVADGDIGSGSV IIKPFVDMEHPETS IKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD LK SGFLQFFLAPKFNDEE


    Database link: P15873

  • Positive control

    • Crude extract of S cerevisiae strain BY4741.

Properties

Applications

Our Abpromise guarantee covers the use of ab221196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 29 kDa.

Target

  • Function

    This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.
  • Sequence similarities

    Belongs to the PCNA family.
  • Post-translational
    modifications

    Upon methyl methanesulfonate-induced DNA damage, mono-ubiquitinated by the UBE2B-RAD18 complex on Lys-164. This induces non-canonical polyubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH, which is required for DNA repair. 'Lys-63' polyubiquitination prevents genomic instability on DNA damage. Monoubiquitination at Lys-164 also takes place in undamaged proliferating cells, and is mediated by the DCX(DTL) complex, leading to enhance PCNA-dependent translesion DNA synthesis.
    Acetylated in response to UV irradiation. Acetylation disrupts interaction with NUDT15 and promotes degradation.
  • Cellular localization

    Nucleus. Forms nuclear foci representing sites of ongoing DNA replication and vary in morphology and number during S phase. Together with APEX2, is redistributed in discrete nuclear foci in presence of oxidative DNA damaging agents.
  • Information by UniProt
  • Database links

    • Alternative names

      • ATLD2 antibody
      • cb16 antibody
      • Cyclin antibody
      • DNA polymerase delta auxiliary protein antibody
      • etID36690.10 antibody
      • fa28e03 antibody
      • fb36g03 antibody
      • HGCN8729 antibody
      • MGC8367 antibody
      • Mutagen-sensitive 209 protein antibody
      • OTTHUMP00000030189 antibody
      • OTTHUMP00000030190 antibody
      • PCNA antibody
      • Pcna/cyclin antibody
      • PCNA_HUMAN antibody
      • PCNAR antibody
      • Polymerase delta accessory protein antibody
      • Proliferating cell nuclear antigen antibody
      • wu:fa28e03 antibody
      • wu:fb36g03 antibody
      see all

    Images

    • Anti-PCNA antibody (ab221196) at 1/1000 dilution + Crude extract of S cerevisiae strain BY4741 at 20 µg

      Predicted band size: 29 kDa

    References

    This product has been referenced in:

    • Janke R  et al. Pivotal roles of PCNA loading and unloading in heterochromatin function. Proc Natl Acad Sci U S A 115:E2030-E2039 (2018). Read more (PubMed: 29440488) »
    See 1 Publication for this product

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab221196.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up