Overview

  • Product name

    Anti-PCNA antibody [PCNA/694]
    See all PCNA primary antibodies
  • Description

    Mouse monoclonal [PCNA/694] to PCNA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Zebrafish, Cynomolgus monkey, Chinese hamster
  • Immunogen

    Recombinant full length protein corresponding to Human PCNA aa 1-261.
    Sequence:

    MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQL TLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRD LSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYY LAPKIEDEEGS


    Database link: P12004

  • Positive control

    • WB: HepG2 cell lysate. IHC-P: Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab220208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 29 kDa.
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(for 30 minutes at RT)

Target

  • Function

    This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.
  • Sequence similarities

    Belongs to the PCNA family.
  • Post-translational
    modifications

    Upon methyl methanesulfonate-induced DNA damage, mono-ubiquitinated by the UBE2B-RAD18 complex on Lys-164. This induces non-canonical polyubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH, which is required for DNA repair. 'Lys-63' polyubiquitination prevents genomic instability on DNA damage. Monoubiquitination at Lys-164 also takes place in undamaged proliferating cells, and is mediated by the DCX(DTL) complex, leading to enhance PCNA-dependent translesion DNA synthesis.
    Acetylated in response to UV irradiation. Acetylation disrupts interaction with NUDT15 and promotes degradation.
  • Cellular localization

    Nucleus. Forms nuclear foci representing sites of ongoing DNA replication and vary in morphology and number during S phase. Together with APEX2, is redistributed in discrete nuclear foci in presence of oxidative DNA damaging agents.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATLD2 antibody
    • cb16 antibody
    • Cyclin antibody
    • DNA polymerase delta auxiliary protein antibody
    • etID36690.10 antibody
    • fa28e03 antibody
    • fb36g03 antibody
    • HGCN8729 antibody
    • MGC8367 antibody
    • Mutagen-sensitive 209 protein antibody
    • OTTHUMP00000030189 antibody
    • OTTHUMP00000030190 antibody
    • PCNA antibody
    • Pcna/cyclin antibody
    • PCNA_HUMAN antibody
    • PCNAR antibody
    • Polymerase delta accessory protein antibody
    • Proliferating cell nuclear antigen antibody
    • wu:fa28e03 antibody
    • wu:fb36g03 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling PCNA with ab220208 at 1 µg/mL.

  • Anti-PCNA antibody [PCNA/694] (ab220208) at 1 µg/ml + HepG2 cell lysate

    Predicted band size: 29 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up