Anti-PCOLCE antibody (ab220040)
Key features and details
- Rabbit polyclonal to PCOLCE
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PCOLCE antibody
See all PCOLCE primary antibodies -
Description
Rabbit polyclonal to PCOLCE -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PCOLCE aa 298-373.
Sequence:PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMV REPGEGLAVTVSLIGAYKTGGLDLPS
Database link: Q15113 -
Positive control
- ICC/IF: U-2 OS cells. WB: U-251 MG cell lysate, human plasma and tonsil tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220040 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 48 kDa. |
Target
-
Function
Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
C-terminal processed part of PCPE (CT-PCPE) may have an metalloproteinase inhibitory activity. -
Sequence similarities
Contains 2 CUB domains.
Contains 1 NTR domain. -
Post-translational
modificationsC-terminally processed at multiple positions. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 5118 Human
- Omim: 600270 Human
- SwissProt: Q15113 Human
- Unigene: 202097 Human
-
Alternative names
- PCOC1_HUMAN antibody
- Pcolce antibody
- PCOLE 1 antibody
see all
Images
-
Immunofluorescent analysis of formalin fixed, triton X-100 permeabilized U-2 OS cells labeling PCOLCE using ab220040 at 4 μg/ml (green).
-
All lanes : Anti-PCOLCE antibody (ab220040) at 1/100 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 48 kDa
Protocols
Datasheets and documents
References (0)
ab220040 has not yet been referenced specifically in any publications.