Overview

  • Product name

  • Description

    Rabbit polyclonal to PCPE-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human PCPE-2 aa 297-415. (N-terminal His-tag and S-tags; Expressed in E.coli).
    Sequence:

    CQQKCRRTGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSIINIYKEGN LAIQQAGKNMSARLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFI MMFKTKNQKLLDALKNKQC


    Database link: Q9UKZ9

  • Positive control

    • IHC-P: Human liver, stomach, kidney, cerebrum, prostate and colorectal cancer tissues. WB: Mouse heart tissue lysate; Recombinant human PCPE-2 protein.
  • General notes

    Previously labelled as PCOLE2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab232721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 46 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
  • Tissue specificity

    Highly expressed in the heart, trabecular meshwork, pituitary gland, bladder, mammary gland, trachea and placenta and weakly expressed in the brain. Expressed in cartilage.
  • Sequence similarities

    Contains 2 CUB domains.
    Contains 1 NTR domain.
  • Post-translational
    modifications

    O-glycosylated; contains sialic acid.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2400001O18Rik antibody
    • MGC187469 antibody
    • PCOC2_HUMAN antibody
    • PCOLCE 2 antibody
    • Pcolce2 antibody
    • PCOLE 2 antibody
    • PCOLE2 antibody
    • PCPE 2 antibody
    • PCPE-2 antibody
    • PCPE2 antibody
    • Procollagen C endopeptidase enhancer 2 antibody
    • Procollagen C proteinase enhancer 2 antibody
    • Procollagen C-endopeptidase enhancer 2 antibody
    • Procollagen C-proteinase enhancer 2 antibody
    • Procollagen COOH terminal proteinase enhancer 2 antibody
    • Procollagen COOH-terminal proteinase enhancer 2 antibody
    see all

Images

  • Anti-PCPE-2 antibody (ab232721) at 2 µg/ml + Recombinant human PCPE-2 protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 46 kDa

  • Anti-PCPE-2 antibody (ab232721) at 2 µg/ml + Mouse heart tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 46 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PCPE-2 using ab232721 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PCPE-2 using ab232721 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PCPE-2 using ab232721 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for PCPE-2 using ab232721 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for PCPE-2 using ab232721 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for PCPE-2 using ab232721 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up