Overview

  • Product name

  • Description

    Rabbit polyclonal to PCYOX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse PCYOX1 aa 249-505. (Expressed in E.coli).
    Sequence:

    AVEGGNKIVCSGLLQASSSNLISGSVMSIEEKTRTKQTGNPTKMYEVVYK TGSETHSDFYDIVLVAAPLNRKMSNITFRNFDPPIEEFNDPYQQLVTTFI KGELNSTLFSSRPKDQFGLSAILVTDDSDMFINSLSIVASVRQKEGPPPA VDGMHVWKTFSRDILTKEQISKLFLSYDYAVRKPWLSYPHYEPPQKCPSI ILHDRLYYLNGIEFAASCMEMSAIAGYNAALLAYHRWNGNEDMIDQDDLY ERLKTEL


    Database link: Q9CQF9

  • Positive control

    • WB: Recombinant mouse PCYOX1 protein; Mouse liver, heart, testis and kidney lysates. IHC-P: Mouse kidney, stomach, heart and uterus tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 56 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Involved in the degradation of prenylated proteins. Cleaves the thioether bond of prenyl-L-cysteines, such as farnesylcysteine and geranylgeranylcysteine.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the prenylcysteine oxidase family.
  • Post-translational
    modifications

    The protein is glycosylated at one or more potential N-glycosylation sites.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 1.8.3.5 antibody
    • KIAA0908 antibody
    • PCL1 antibody
    • PCYOX_HUMAN antibody
    • PCYOX1 antibody
    • Prenylcysteine lyase antibody
    • Prenylcysteine oxidase 1 antibody
    • Prenylcysteine oxidase precursor antibody
    see all

Images

  • Paraffin-embedded mouse kidney tissue stained for PCYOX1 using ab231901 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse stomach tissue stained for PCYOX1 using ab231901 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse heart tissue stained for PCYOX1 using ab231901 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse uterus tissue stained for PCYOX1 using ab231901 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PCYOX1 antibody (ab231901) at 1 µg/ml + Recombinant mouse PCYOX1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

  • All lanes : Anti-PCYOX1 antibody (ab231901) at 1 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse heart lysate
    Lane 3 : Mouse testis lysate
    Lane 4 : Mouse kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

References

ab231901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up