Overview

  • Product name

    Anti-PD-L1 antibody [ABM4E54]
    See all PD-L1 primary antibodies
  • Description

    Mouse monoclonal [ABM4E54] to PD-L1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PD-L1 aa 18-227.
    Sequence:

    AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS YGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW TSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPE ENHTAELVIP


    Database link: Q9NZQ7-1

  • Positive control

    • Recombinant protein fragment of Human PD-L1; Human Hodkin's lymphoma tissue. Programmed death-ligand 1 (PD-L1) expression in various tumor types - http://www.immunotherapyofcancer.org/content/1/S1/P53

Properties

Applications

Our Abpromise guarantee covers the use of ab210931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 33 kDa.
Flow Cyt Use a concentration of 1 - 2 µg/ml.

Target

  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production.
  • Tissue specificity

    Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane and Endomembrane system.
  • Information by UniProt
  • Database links

  • Alternative names

    • B7 H antibody
    • B7 H1 antibody
    • B7 homolog 1 antibody
    • B7-H1 antibody
    • B7H antibody
    • B7H1 antibody
    • CD 274 antibody
    • CD274 antibody
    • CD274 antigen antibody
    • CD274 molecule antibody
    • MGC142294 antibody
    • MGC142296 antibody
    • OTTHUMP00000021029 antibody
    • PD L1 antibody
    • PD-L1 antibody
    • PD1L1_HUMAN antibody
    • PDCD1 ligand 1 antibody
    • PDCD1L1 antibody
    • PDCD1LG1 antibody
    • PDL 1 antibody
    • PDL1 antibody
    • Programmed cell death 1 ligand 1 antibody
    • Programmed death ligand 1 antibody
    • RGD1566211 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human Hodkin's lymphoma tissue, labeling PD-L1 with ab210931at 5 µg/mL.

  • Anti-PD-L1 antibody [ABM4E54] (ab210931) at 0.5 µg/ml + Recombinant protein fragment of Human PD-L1

    Predicted band size: 33 kDa

  • Cell Surface flow cytometry analysis of PD-L1 in PHA treated human PBMC using 1 μg of ab210931. Green represents isotype control; pink represents ab210931 antibody. Goat anti-mouse PE conjugate was used as secondary antibody.

     

  • All lanes : Anti-PD-L1 antibody [ABM4E54] (ab210931) at 2 µg/ml

    Lane 1 : A549 lysate
    Lane 2 : MCF-7 lysate
    Lane 3 : 293 lysate
    Lane 4 : HCT-116 lysate
    Lane 5 : Saos2 lysate
    Lane 6 : HeLa lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 33 kDa



    Exposure time: 1 minute in film and 30 seconds in imager.

References

This product has been referenced in:

  • Lu B  et al. Analysis of PD-L1 expression in trophoblastic tissues and tumors. Hum Pathol 84:202-212 (2019). Read more (PubMed: 30339966) »
  • Kathuria H  et al. NKX2-1-AS1 negatively regulates CD274/PD-L1, cell-cell interaction genes, and limits human lung carcinoma cell migration. Sci Rep 8:14418 (2018). Read more (PubMed: 30258080) »
See all 6 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Monkey Tissue sections (SVV-infected Rhesus Lung Tissue)
Antigen retrieval step
Enzymatic - Buffer/Enzyme Used: Citrate Buffer
Permeabilization
Yes - Triton X100
Specification
SVV-infected Rhesus Lung Tissue
Blocking step
Serum as blocking agent for 20 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Colin Coleman

Verified customer

Submitted Aug 11 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up