Overview

  • Product name

  • Description

    Rabbit polyclonal to PD-L2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat PD-L2 aa 21-268. (Expressed in E.coli).
    Sequence:

    FTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQS QRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVK ASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTP EGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPRT RSLHAFIPACTVALIFLATVIAQRKRLWGKLYSRKRSEPAVLGVGKIQ


    Database link: D4AAV6

  • Positive control

    • WB: Recombinant rat PD-L2 protein; Rat spleen lysate. IHC-P: Rat pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231145 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 30 kDa.

Target

  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity

    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt
  • Database links

  • Alternative names

    • B7 dendritic cell molecule antibody
    • B7-DC antibody
    • B7DC antibody
    • bA574F11.2 antibody
    • Btdc antibody
    • Butyrophilin B7 DC antibody
    • Butyrophilin B7-DC antibody
    • Butyrophilin B7DC antibody
    • CD 273 antibody
    • CD273 antibody
    • CD273 antigen antibody
    • MGC142238 antibody
    • MGC142240 antibody
    • PD 1 ligand 2 antibody
    • PD L2 antibody
    • PD-1 ligand 2 antibody
    • PD-L2 antibody
    • PD1 ligand 2 antibody
    • PD1L2_HUMAN antibody
    • PDCD 1 ligand 2 antibody
    • PDCD1 ligand 2 antibody
    • PDCD1L2 antibody
    • Pdcd1lg2 antibody
    • PDL 2 antibody
    • PDL2 antibody
    • Programmed cell death 1 ligand 2 antibody
    • Programmed death ligand 2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for PD-L2 with ab231145 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PD-L2 antibody (ab231145) at 2 µg/ml + Recombinant rat PD-L2 protein

    Predicted band size: 30 kDa

  • Anti-PD-L2 antibody (ab231145) at 2 µg/ml + Rat spleen lysate

    Predicted band size: 30 kDa

References

ab231145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up