Anti-PD-L2 antibody (ab244332)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PD-L2 antibody
See all PD-L2 primary antibodies -
Description
Rabbit polyclonal to PD-L2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PD-L2 aa 147-220.
Sequence:GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWN THVRELTLASIDLQSQMEPRTHPT
Database link: Q9BQ51 -
Positive control
- ICC/IF: U-2 OS cells. IHC-P: Human tonsil, fallopian tube, stomach and lung tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab244332 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. -
Tissue specificity
Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Secreted; Cell membrane and Endomembrane system. - Information by UniProt
-
Database links
- Entrez Gene: 80380 Human
- Omim: 605723 Human
- SwissProt: Q9BQ51 Human
- Unigene: 532279 Human
- Unigene: 617872 Human
-
Alternative names
- B7 dendritic cell molecule antibody
- B7-DC antibody
- B7DC antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PD-L2 antibody (ab244332)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling PD-L2 using ab244332 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PD-L2 antibody (ab244332)Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for PD-L2 with ab244332 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PD-L2 antibody (ab244332)Formalin-fixed, paraffin-embedded human stomach tissue stained for PD-L2 with ab244332 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PD-L2 antibody (ab244332)Formalin-fixed, paraffin-embedded human lung tissue stained for PD-L2 with ab244332 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PD-L2 antibody (ab244332)Formalin-fixed, paraffin-embedded human tonsil tissue stained for PD-L2 with ab244332 at a 1/50 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab244332 has not yet been referenced specifically in any publications.
